!c99Shell v. 1.0 pre-release build #16!

Software: Apache/2.2.3 (CentOS). PHP/5.1.6 

uname -a: Linux mx-ll-110-164-51-230.static.3bb.co.th 2.6.18-194.el5PAE #1 SMP Fri Apr 2 15:37:44
EDT 2010 i686
 

uid=48(apache) gid=48(apache) groups=48(apache) 

Safe-mode: OFF (not secure)

/usr/sbin/   drwxr-xr-x
Free 52.28 GB of 127.8 GB (40.91%)
Home    Back    Forward    UPDIR    Refresh    Search    Buffer    Encoder    Tools    Proc.    FTP brute    Sec.    SQL    PHP-code    Update    Feedback    Self remove    Logout    


Viewing file:     lvchange (728.23 KB)      -r-xr-xr-x
Select action/file-type:
(+) | (+) | (+) | Code (+) | Session (+) | (+) | SDB (+) | (+) | (+) | (+) | (+) | (+) |
ELF34\ 4 (44p4p44q4qpp  xE8   HHqHq Ptd O  ,&,&Qtd/lib/ld-linux.so.2GNU      @ HWGD! :DV@RD"L#0*Ncˢ%E8B1  @@PAРegĪ )C "#PP"E$ QyK#l: H4B2eb" 4e  )G=bE P# i -A!%R9DQ!&"!ACx)  "qB3@1HD 7 DtP{ (PbO(,H  &&BJC$;p@! !'$" h E (V)A(,$@D fl 56ҧ# (ϾM )B#)VEh/H!ё'DʀA  @&$TxP0 !#$&'(*+./134678;>?BCEFHJKLMPQTVXZ\^_`abcdfgijlmnostuwxyz{  #'*+.12456789;<=?ACFHKNPQRSVWXY]`cdfhikmpstuwyz}~   "$%()+,-/12369;<=?@AEFGHJNOPRTUVWXY]^bcfhjlmnoqstuvwyz|Oٞv@CDДfsMLTeF\Z(l̦Kl(Pc2#wڏh6 ?֯`Ne=jPmkNo8.)#a*y t.nt]btTBKLKG' XGr Ar6u2dmƽTRuM }/ $L?5Onħ/K {fR˩UR=ʬ[ : 5pHz/i-_ZA]3]#0/B_ `-]o\L@T&`!6+0O$0?&Ie8x0I~c!d 4PEHOo)טhPBTĽ @4&|`k^N:y"mF^xMdl ֧1zQv  t؎)?MWI v&]]gm7(F%Ɵ=mU!3b=YR6۞0\(O. q"1NZh9IKvep,i'7kC^А:SłVIdzAΰԋK:!sL8L _~!'T[hԝ\eyW =؋ gv g[V9 _Ę/EMʺTFAe&/APA6^O\׬WZcDQVK":?UCE9'FD}!j7"FzK^']T\"52a2HlsQ}[}WŚl4) FaRWVHM'/FW}_>+eMQظr.ӮMֽ (2c/:z`Y@ϟ09~A? |`8qEnA]GqўoYdzš PaD4~+0H(x\Rv",=wc]{>b:(NaZvp'V T[[JWӍ9wl?~#aVYb[V,OR< xobs4= ]D! ݾ=+ 78YFsN cKls5pOrwPɆÙrZ$U t͔c9ٵл܄f DALRv qYauϠCM'zn^.]3rvxv /DFS9FեpB^iсxw3WP9@1 vҕU1z,2Hrlq+ hCnoBqqVF1vFUҗ| T-D^8(SOR\oW{cF?||?[bf;){OK{gY6]1zG1*0ygwZ$t+i'q1c1Z%ȖIR \ZeƴDiu |t˘3FO͊fBJ `?##|ājڰ2hޮ=|Us"C>$9:+.)$K`0ğZVjrsmk)wcB^1u:jT"[>LZ8DDV -TҪaB Fv@!u͉>&7lHw'9P$5d 7-. Yco.0$_?>Łg9 QgcLꤸ14u6{2]nPRw#=ǹ{)jL6x6yRִvY{eAo-^[Z r=zVzL|%eRnnA>E񂟳nŁ؞nk Cd; %˃ K'5;|ԗd+?W,)N1z NSk1Y$T`B@X˞zE:>OGfavA]Hͳw4B 7|6~̇= &8Ыs8Z>غ! )pn6xD݆/槯HikBw-L!+K)\f\kaf Z|5FWUU6:\!(GPMAǕzἰHNe<4 "k|L061 ( N ,+7OA͑U= __õD^cתM}<;_Ci՛k՚R(2mORoetudg9l^\~KSHRɵJ *[qX?vhGw24EQ\YY_ #}YTlp*XBDrˡ.0$l49sT_TNWQJJZϦȲd]lcB)7o4& I r= 1) >)lV :fr z7 &m ;e' /#  ,v + /  2   F=h $ Pe 3D Ag C 2wN ! ,vMA> ? t y> X^ 2 ! L2U.FP2\}  :1D .]3 CX F7v)  Hi@  { F L EHk$>aL 8  TK@  R [i G` > @w = @ VN\ R'#{6kp   F 7  P  2cP  :^EpC z   U r~  "1 g g    [8:jE]y y$xb pPxMeW  I Uk_je#  T  N  =XsF9\  6Z :{vF dH7 _N rl @s Y@U 7@ gaE E%`LE  FdBR > 4+ 2   >4l J 9V > 2+yt8B)yW> t ?>D"T W z - %sX 9$ 10 !6  k0 1 &g 0@H4 x5@4`a4pwO) D)+ @ %pH &F A b&}D'tEo k e& pO&o P5'P ~/` 9Pr 2 <$`O < )P  %30! U7P @qM1 e  s)P2o  pp94 {P3% v ^( +Pp  z x 8 6# l6 `~ =e >pL +.l2 q@ gPlM@`_%pD` *9 " pT+w  ^(PLU50>+ m` 4@ 80@X *9e@5(b.P   g AR1`7*Ќ PP*0!p <" )2o  -=7q(2iQ-0e 6,@ p,#A Jo i2P8!K3 .p V d!p xe/ k D5" SL85rr%  'PW  q p#hn.(( 5)n /L ,< `"P 6 e u %]JD40 fP 4R+ p` }s(8a10 D4 D@9.`P/ {&6pmf4x$-P 2p6 . u* w B/ 3v E "% Ѓ6 C-ZX- Tz >&аU9`   "2  A* K@]* p {2vpo   *G2 c/-*e &8 vq vb+ K D, K9M  $P #,  *peh3 ` O``^' pP n+p  J)b qp2f ) :m %0vLu & Ss%,7 g %f ! < 40 0` % \ W+0  9@p   !J @$0- s& +3P y/0/] Vr$l 3о x'2730  2 >38 = \ ?e ! *Pu  @R) 4Y jzp   y|kW(Ћ 5M a[ D_4 e*&n (3S* &la)  P 6 J ~1 9 L50(+Pj3@\8Z!' i V M9.P0 h ? T)pn & ?R8@1P 60R_ b  RP MPG @\-p  #" [#@ .)%C) Y5[ _p  " 7w wm!0 !j"x6l %7+5o/ $"P 0P "\7 %/`".5: <% i&:s r8P l^9 '-6 -:o & *r  >5]  "!`j :$`i /"@ 2d D0m ,Ж <6'0@h D T  M@l O!|.".2@ s2 ` ( 4o м Wp  /#Ѓf&P,(L9 7%P f O' 7`$ @ ;Q20V- g J0I #7c+HB i# " ! d5p 0 Y)$n ;$P_ ) 0` a0Z2` 7( > "~ ]4 Uh$~ @6` 6 .Y!@ +V$ ?,>N"R  !@ "/$иP@8 F8 L-3Pr2p58pB ,s$`3s$R *& G*Or1zP (81p/ 4o  !1<o(П\`7 7 ' ,D5 \#P yn'; p.u@( S>)q840Wp .u , 9@v3@g ?%P T94>`g %0 /pl 1#` ])p7#5u=upG '0 1d '0p  pe 1 7!p)%y897@n (1Ph = `h+0`mopp  r`1{ 3Pe 5 7pk   >0 1']0PoPL#@ i 9 3k p  2n 8j*@ |c{Ps!pk & w^ h -Й [/0 G6 7-@j+@   2jDx   5 -] Z:Pw <)05` A# ,00 900f (`!`7/Pm w7 1pD.  q (pPF!0o < Q>s<(>6 5H: 18`h <e  , X5$>%[8Up\*S, [Pv b- u:* . h  g( j *( '9E Cp  g M0`/$ r, -|#0; X eF," e KPܨ_ x + 6lU-,L&5_16+ u 0 8(Z  !5 $s d 8W&o  8O T Up X` &4`Q p- 3@;S:% 6 "+p/ J00hFjOd) *98  i5T x@L8ЄQ4Y 0f (.7r  !j V09i#u ^2@X =V< : @ KM#0 ;1g ,)-$0 *T. Ve1;,P{7P55`m 28 Gt *0"' P / $g (A 4 q Z4CJ"4`P RQ)I '~3 4m ./@M jJ3Z 3 g$ 9 "qu9`  $,o  %m /6m )`f 00` &018AZ3+pd ?3P  N{*p5 0sr&* x hKy"@ .`p  9 x` xD ` :cq  L6"0nP\'"4-9fЛ -%W PLfP KK6  h j77P ]ep '  `\8>59q 7t P`6 F76( P>#@7 , <1P# ~ )&p 9* P30p?W z'B f3@ $ R 1 .t s4`l&U% @l @ ~]XTH0J |7b "pP f  jo   8 W01) 0[ $N! 8 o  Sb x!Л)P xl S0fD X0> &[p \q- cP5 ;& & +3xO\ o "  #p, ,P@30 j EP :w _|-2 "89Ф0r ( MeMS"MK& M M쌌i M8& MhP1N M`x ^ M::Mq5. ++,+`0+ @+P+0zX+$d+zl+@p+@t+x+0+%++0{++ ++@(++N<`0{x@ D`0\@謅0zpz u $0{įدpH|op` pP}`p0zdppz q0{Pq|xqP~2`0_XY0Z0_4X8Y<0Z<`0ztz腊H0{^^^^^^p_ 8_<_____̿п0Կؿܿٳlibdevmapper-event.so.1.02__gmon_start___Jv_RegisterClassesdm_task_set_uuiddm_task_rundm_malloc_auxdm_task_createdm_task_destroydm_task_get_namedm_task_set_namedm_task_get_infodm_event_handler_set_dev_namedm_event_handler_createdm_event_unregister_handlerdm_event_handler_set_event_maskdm_event_get_registered_devicedm_event_handler_destroydm_event_register_handlerdm_event_handler_set_dsodm_event_handler_set_timeoutdm_event_handler_get_event_masklibpthread.so.0sigaction__errno_locationforkconnectlseek64fsyncfcntllibdevmapper.so.1.02dm_report_objectdm_pool_grow_objectdm_report_initdm_tree_add_devdm_regex_matchdm_tree_suspend_childrendm_report_outputdm_tree_createdm_list_nextdm_report_set_output_field_name_prefixdm_tree_node_add_snapshot_targetdm_hash_insertdm_tree_node_get_uuiddm_pool_strdupdm_tree_node_get_contextdm_tree_find_nodedm_create_dirdm_tree_set_cookiedm_split_lvm_namedm_pool_freedm_fclosedm_tree_add_new_dev_with_udev_flagsdm_tree_add_new_devdm_report_freedm_pool_allocdm_get_library_versiondm_task_set_major_minordm_tree_children_use_uuiddm_hash_wipedm_tree_find_node_by_uuiddm_hash_createdm_driver_versiondm_list_movedm_hash_destroydm_report_field_uint64dm_tree_node_add_target_areadm_tree_node_size_changeddm_udev_set_sync_supportdm_tree_node_add_mirror_target_logdm_pool_abandon_objectdm_dirdm_list_sizedm_pool_end_objectdm_hash_iterdm_pool_zallocdm_pool_destroydm_snprintfdm_is_dm_majordm_set_dev_dirdm_bitset_createdm_pool_createdm_list_add_hdm_list_adddm_list_initdm_mknodesdm_split_wordsdm_report_field_set_valuedm_report_field_uint32dm_log_with_errno_initdm_tree_activate_childrendm_lib_releasedm_tree_node_add_error_targetdm_report_field_int32dm_pool_emptydm_tree_node_add_zero_targetdm_tree_node_set_read_aheaddm_tree_node_get_namedm_tree_node_add_linear_targetdm_hash_lookupdm_task_no_open_countdm_hash_get_nextdm_udev_get_sync_supportdm_task_get_versionsdm_tree_node_add_mirror_targetdm_hash_get_firstdm_regex_createdm_tree_deactivate_childrendm_list_deldm_report_field_intdm_tree_preload_childrendm_tree_use_no_flush_suspenddm_task_get_read_aheaddm_tree_skip_lockfsdm_tree_next_childdm_lib_exitdm_set_selinux_contextdm_pool_begin_objectdm_hash_removedm_list_firstdm_tree_freedm_pool_strndupdm_hash_get_num_entriesdm_udev_waitdm_report_field_stringdm_tree_node_add_snapshot_origin_targetdm_list_lastdm_hash_get_datadm_list_emptydm_tree_node_add_striped_targetdm_hash_get_keydm_get_next_targetdm_task_set_event_nrdm_tree_get_cookielibreadline.so.5write_historyrl_readline_namehistory_lengthread_historyremove_historyreadlinerl_completion_matchesrl_line_bufferrl_attempted_completion_overstifle_historyrl_attempted_completion_functionadd_historylibselinux.so.1libsepol.so.1libdl.so.2dlopendlsymdlclosedlerrorlibncurses.so.5libc.so.6_IO_stdin_usedsocket__xpg_basenamefflushstrcpysetlocalefopenstrncmpoptindstrrchr__strdupmmap64closedirsiginterruptstrncpysignalgetprioritysigprocmasksigfillsetunlinkputcharmkdirreallocstdingetpid__assert_failflockctime_rsymlinkalphasort64fgetsgetppidstrlenopenlogdirnamememsetstrstrrmdirunsetenvrand_r__fxstat64__vprintf_chk__fprintf_chksigaddsetctimestdoutfputc__strtoll_internalfputsmemcpy__strtol_internal__vsnprintf_chkmunlockallmallocstrcatumaskstrcasecmp__strncpy_chk__lxstat64opendir__xstat64getenv__ctype_b_locsscanfoptargstderrsigdelsetioctlmunmapwait4__snprintf_chkgetuidreadlinkgetopt_longexecvpgethostnamefwritegeteuidsigismembermlockallstrchrscandir64__vfprintf_chkmalloptfdopenreaddir64qsort__strtod_internal__vsyslog_chksleep__ctype_toupper_loc__strcpy_chk__ctype_tolower_locsetsidgetrlimit64__sprintf_chk__xstatunamefopen64access_IO_getcstrcmpstrerror__libc_start_mainferrorsetprioritycloselog__strtoul_internal__stack_chk_fail_edata__bss_start_enddev_manager_createlvmcache_drop_metadatadev_manager_device_uses_vgexport_uuidscollapse_mirrored_lvvginfo_from_vgidpvcreatelv_is_origininit_snapshot_segtypealloc_snapshot_segcheck_lv_segmentscreate_toolcontexttag_argmove_pvget_config_strpvdisplayremote_lock_heldlvid_from_lvnumdev_manager_infoblkext_majorlv_remove_mirrorslvmcache_get_vgidsarg_sign_valueinit_debugarchive_enabledev_manager_exitpvcklv_emptyarg_valueimport_pool_lvstext_vg_export_rawvg_max_lvimport_pvspvdisplay_shortlv_snapshot_percentset_lv_segment_area_lvvgextendinit_sysloglv_suspenddev_writelvid_in_restricted_rangeinit_pvmovelvresizedevice_from_pvidcheck_current_backupconsume_pv_areavg_reduce__libc_csu_finidev_md_stripe_widthadd_daemit_to_bufferlv_mirror_percentdev_optimal_io_sizelvs_in_vg_activatedpoll_daemoninit_security_levellabel_get_handlerinit_ignore_suspended_devicesget_config_uint32vgdisplay_fulltext_vg_import_filevg_lock_newnamelock_volimport_pool_pvsigint_caughtlvmcache_get_vgnamesfind_pvmove_lv_from_pvnamearg_percent_valuevgchangearg_uint_valuedel_mdassize_kb_argbackup_listpv_readuuid_from_numbackup_enabledestroy_config_treefind_pvread_pvs_in_vgdel_dasfind_pv_in_vgvg_removevg_set_clustereddev_openadd_mirrors_to_segmentsinit_cmd_namevg_mda_countlvconvertfs_rename_lvscan_vgs_for_pvsinit_external_lockingescaped_lenexport_lvsbtree_get_datavgmknodeslvmcache_update_vgname_and_idpv_analyze_fp_hwvg_visible_lvsrelease_pv_segmentlvm_run_commandpv_max_name_lencalc_crcdev_is_mdlv_calculate_readaheadvgscanvgcreatearg_ptr_value_really_wipevgckinit_lvminit_mirror_in_syncprocess_each_pv_in_vgexec_cmdpersistent_filter_wipedev_get_sizeset_pe_align_offsetdefault_vgnamevgcreate_params_set_defaultspv_resizeget_config_uint64remove_lvs_in_vglvmcache_destroyinit_dmeventd_monitorvg_sizepv_pe_startfs_unlockinit_full_scan_donestr_list_match_listexport_vg_to_bufferlvmdiskscanfmt_from_vgnamelv_add_mirror_areasimport_vginit_log_directalloc_lvget_pool_uuidarchive_vgdisplay_formatslvm1_presentget_pv_from_vg_by_iddev_subsystem_nameout_sizedev_closelv_resumestrip_dirfind_config_tree_boolcreate_pv_mapsvg_has_unknown_segmentsimport_lvsimport_pool_vgcopy_percentinit_error_message_producedwrite_config_nodelvdisplay_segmentstarget_presentpv_devexport_numbersread_pool_labelactivation_releaseinit_indentarchive_display_filepool_label_indev_cache_initdev_get_read_aheadstr_list_createimport_vg_from_buffersigint_allowvg_set_max_pvlvs_in_vg_openedlog_suppresslvscanremove_seg_from_segs_using_this_lvtest_modelist_segment_modulesdev_manager_mirror_percentpermission_argset_cmd_namevgcfgrestoreis_reserved_lvnamevgdisplayvg_max_pvpvdisplay_colonsset_activationdev_iter_getimport_pool_pvspv_is_in_vgfind_config_boolfind_config_nodelvmcache_verify_lock_orderimport_extentsint_arg_with_signinit_testtext_vg_vsn1_initlv_mirror_countdev_manager_releasearg_uint64_valuearg_count_incrementvgdisplay_extentsdev_read_circularbackup_to_fileadd_areas_linememlock_dec_daemonlvnum_from_lvidlvm_fintext_vg_import_fdout_newlineprint_flagsvg_refresh_visiblelv_suspend_if_activeinit_log_fnstr_list_dupmaybe_config_sectionvgreducearchive_displaylv_removedisplay_sizeclone_config_nodedev_manager_destroylv_is_cowlocking_is_clusteredlvmcache_lock_vgnamevg_statusunits_to_bytesprocess_each_lvpvmove_modelv_remove_with_dependenciesarg_int64_valueskip_dev_dirconfig_files_changedcreate_text_formatarchive_exitshift_mirror_imageslabel_createcount_charsid_write_formatvgrenametext_vgname_import_text_opsout_config_nodecreate_config_treeactivate_lvsprocess_each_segment_in_pvvgexportlv_add_segmentinit_striped_segtypeunlink_lv_from_vgprint_logmemlock_initpv_pe_countdev_manager_deactivatetext_labeller_createlvmcache_get_pvidsread_vgdis_temporary_mirror_layer__data_startout_inc_indentdev_fdvgsplitpv_disks_foundconfig_file_changedadjusted_mirror_region_sizebackup_initvg_renamelv_renamelv_extendpvchangelvmcache_initdev_subsystem_part_majordev_manager_suspendlabel_register_handlerlv_is_virtual_origindev_iter_createadd_pv_to_vglabel_readlvm_shellbackup_locallylvmsadcverbose_levelvg_releasepvresizebuild_dm_namelv_reducecalculate_layoutvg_write_lock_heldpeg_dupremove_layers_for_segmentspv_sizevgmergeattach_mirror_logout_hintfind_config_tree_nodeunescape_double_quotesread_config_fdpv_vgidinit_zero_segtypelvmcache_addbtree_nextvgs_lockedmonitor_dev_for_eventsfind_lv_in_vglv_sizebuild_dliddev_manager_activatefind_config_tree_floatinit_unknown_segtypesigint_clearpv_by_pathdumpconfiglvs_using_lvvg_max_name_lenextents_from_sizeinit_snapshot_segread_diskdisplay_stripetext_import_areasvg_set_extent_sizevgimportexport_pv_actset_lv_segment_area_pvremove_mirror_logbuild_parallel_areas_from_lvyes_no_promptactivation_exitfind_lv_in_vg_by_lvidlvconvert_polllv_add_mirrorslabel_destroyvg_set_max_lvmemlock_inc_daemonpv_list_extents_freeread_pool_diskvg_read_internalarchive_list_filedev_flushremove_layers_for_segments_allexport_pvlv_add_log_segmentvgs_are_compatiblepv_mda_countpv_idvgname_from_vgidinit_mirrored_segtypegenerate_lv_namevg_validatestr_list_lists_equaldev_manager_lv_mknodesbackup_restorevg_add_snapshotget_segtype_from_stringlv_has_unknown_segmentspool_labeller_createis_empty_dirbackup_removeresume_lvsalloc_argmemlock_incfind_pv_in_vg_by_uuidexport_vglv_resume_if_activemax_partitionspvcreate_params_set_defaultsassign_peg_to_lvsegvgname_from_mdaimport_pool_segmentslvdisplay_fullfind_peg_by_peinfo_from_pviddmeventd_monitor_modedev_cache_scaninit_pool_formatregex_filter_createarchivepv_vg_namelvdisplay_colonspv_dev_namearg_countinit_readonly_lockingdev_setis_pvvgremovewrite_config_fileyes_no_argset_pe_alignalloc_destroylv_info_by_lvidlabel_initlvm_fclosebtree_insert__libc_csu_inithelpbackup_restore_from_fileextract_vgnamelv_create_emptycheck_pv_segmentsvg_extent_sizeconfig_parent_namesigint_restorepvdisplay_segmentslv_is_visiblepvcreate_singlepv_split_segmentarg_is_setid_equalarg_str_valuelvrenamevg_check_statusout_areasget_only_segment_using_this_lvpv_write_orphansuspend_lvsdev_cache_exitread_pool_pdsapply_lvname_restrictionscreate_config_tree_from_stringfind_lvalloc_pv_segment_whole_pvvg_max_lv_reachedlv_remove_singlevgsvgconvertinit_cluster_lockingstored_errnoget_alloc_stringfind_config_tree_intpvdisplay_fullbackup_exitpv_maps_sizefind_cowis_orphanlvm_register_segtyperead_tagsvg_missing_pv_countlvm_splitvg_createimport_lvinit_lockingdev_iter_destroydev_test_exclexport_vg_numberminor_argfs_add_lvsnapshot_countlv_is_activevg_freeget_alloc_from_stringlv_add_virtual_segmentfs_del_lvlvm_register_commandslink_lv_to_vgget_pvmove_pvname_from_lvvg_set_alloc_policyfind_mirror_segrefresh_toolcontextfixup_imported_mirrorsclone_pv_listlvmcache_add_orphan_vginfoprocess_each_vgwrite_diskscheck_lvm1_vg_inactivevg_free_countvg_remove_checkbackup_read_vgtarget_versionpath_existsmajor_argpvcreate_params_validatefin_logvg_remove_mdasremove_mirrors_from_segmentsvg_seqnoarg_int_valuepvremoveexport_extentsget_pvmove_pvname_from_lv_mirrbtree_lookupread_flagsrelease_lv_segment_areadisplay_size_unitsvg_writeimport_snapshotsreplace_lv_with_error_segmentlvm_type_filter_destroyprint_tagsstr_list_match_itemorigin_from_cowmodule_presentdev_close_allinit_trust_cachelv_set_visiblelabel_exitcreate_pv_listdev_create_filefind_pv_by_namefind_config_floatyes_no_excl_argarchive_listlv_split_segmentlv_activate_with_filterlv_spawn_background_pollingvg_pv_countreadahead_arglv_refreshfind_config_strreset_lockingadd_seg_to_segs_using_this_lvsize_mb_arglv_set_hiddenadd_mirror_loglvdisplaylvs_in_vg_activated_by_uuid_onlydev_manager_snapshot_percentfind_temporary_mirrorsysfs_filter_createinit_error_segtypecreate_text_contextinit_log_filelv_activation_filterdev_manager_preloadread_config_filestored_errmsgfind_config_intinsert_layer_for_segments_on_pvreset_lvm_errnodir_existsallocate_extentscreate_temp_namedev_appendinit_no_lockingget_primary_devvalidate_vg_rename_paramsdev_manager_lv_rmnodesvgcreate_params_set_from_argslog_command_nameinit_is_staticdev_alignment_offsetpersistent_filter_dumpremove_layer_from_lvdebug_leveldev_open_quietlvreducelvmcache_get_vginit_verbosepersistent_filter_loadremove_mirror_imagesmove_pvs_used_by_lvfs_del_lv_bynamevgcfgbackupget_shared_library_pathalloc_lv_segmentdisplay_size_longpersistent_filter_createis_partitioned_devlist_lv_modulesdev_cache_add_loopfilevg_read_errorinsert_layer_for_lvvgcreate_params_validatevg_extendlvcreatepool_label_outout_textlvchangevgdisplay_colonsinit_msg_prefixpv_pe_sizeinit_md_filteringfcntl_unlock_filepv_statusfind_config_tree_str_really_initdev_minimum_io_sizevalidate_namebtree_firstdetach_mirror_loglvremovepv_createfind_free_lvnumvgdisplay_shortdev_close_immediatelvm2_mainadd_mdaget_free_vg_numberprocess_each_pvinit_ignorelockingfailureconfig_file_timestampvgname_is_lockedtext_vg_export_filevg_split_mdaslvm_getpagesizevg_remove_snapshotid_read_formatinit_log_while_suspendedint_arg_with_sign_and_percentvg_check_write_moderead_urandompoll_mirror_progressdev_cache_add_dirfcntl_lock_filemunge_pvdpv_pe_alloc_countlv_add_mirror_lvslv_infoadd_mirror_imageslvmsardev_open_flagsfind_seg_by_leinit_lvm1_formatpv_parts_foundload_shared_librarystr_list_delmetadatatype_argsync_dirmove_lv_segment_areadev_readcomposite_filter_createbtree_create_lvm1_opsdisplay_segtypesinit_lvmcache_orphansdev_name_confirmedpv_uses_vgreconfigure_mirror_imageslvm1_labeller_createfin_lockinglvm_type_filter_createinit_file_lockingstring_arglv_deactivateinit_free_segtypefind_pv_in_pv_liststr_list_addfirst_seg_pool_opspvmove_pollid_validprocess_each_lv_in_vglv_from_lvidlabel_verifyis_orphan_vgdev_cache_has_scannedsplit_parent_segments_for_layerlvm_renameout_dec_indentlv_merge_segmentslvmcache_label_scanvg_readimport_pvoverride_config_tree_from_stringmerge_config_treelv_activatedev_is_swaparchive_initlabel_removevg_read_for_updatelabel_writelvextendlvmcache_unlock_vgnameset_lvdestroy_toolcontextsegtype_argrefresh_filterslvid_createlvmcache_commit_metadatapv_format_typemerge_pv_segmentsdev_cache_getget_pvsint_argvg_extent_countvg_commitlv_create_singlevginfo_from_vgnamelvmchangemd_majorcalculate_extent_countvg_revertmax_lenmemlock_declvmcache_update_vgpv_writebackup_restore_vgdev_set_preferred_namefind_pvmove_lvprocess_each_segment_in_lvfind_lv_in_lv_listmd_filter_createpvscanmemlockrelease_log_memoryfin_syslogpvdatadevice_is_usableGLIBC_2.1GLIBC_2.0BaseGLIBC_2.2GLIBC_2.4GLIBC_2.3GLIBC_2.3.4/lib/ld-linux.so.2             & 0ii k:ii u: :" :0ii :ii u:^ ii :ii :ii k:ii :ti :ii u:(,~048K<@ DHLPTXK\`)dhlp|t"x|&O[ *"]ĄȄ8̄VЄԄ؄܄^s`Ph} q e$(,048O<@fDHLPT<X0hlptx|    ąȅ̅Ѕԅ؅܅ !#$%&'()*+, -./01 2$3(4,5064788<9@:D;H<L=P>T?X@\A`BdChDlEpFtGxH|IJKLMNOPQRSTUVWXYZĆ\Ȇ]̆^І_Ԇ`؆a܆bcdefghijklm nopqr s$t(u,v0w4x8y<z@{D|H}L~PTX\`dhlptx|ćȇ̇Їԇ؇܇  $(,048<@DHLPTX\`dhlptx|ĈȈ̈ЈԈ؈܈  $(,048<@DHLPTX \ ` d UE5`%d%hh%lh%ph%th%xh %|h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%ąhp%ȅh`%̅hP%Ѕh@%ԅh0%؅h %܅h%h%h%h%h%h%h%h %h(%h0%h8p%h@`% hHP%hP@%hX0%h` %hh% hp%$hx%(h%,h%0h%4h%8h%<h%@h%Dhp%Hh`%LhP%Ph@%Th0%Xh %\h%`h%dh%hh%lh%ph%th%xh %|h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%Ćhp%Ȇh`%̆hP%Іh@%Ԇh0%؆h %܆h%h%h%h%h%h%h%h %h(%h0%h8p%h@`% hHP%hP@%hX0%h` %hh% hp%$hx%(h%,h%0h%4h%8h%<h%@h%Dhp%Hh`%LhP%Ph@%Th0%Xh %\h%`h%dh%hh%lh%ph%th%xh %|h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%ćhp%ȇh`%̇hP%Їh@%ԇh0%؇h %܇h%h%h%h%h%h%h%h %h(%h0%h8p%h@`% hHP%hP@%hX0%h` %hh% hp%$hx%(h%,h%0h%4h%8h%<h%@h%Dhp%Hh`%LhP%Ph@%Th0%Xh %\h%`h%dh%hh%lh%ph%th%xh %|h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%Ĉhp%Ȉh`%̈hP%Јh@%Ԉh0%؈h %܈h%h%h%h%h%h%h%h %h(%h0%h8p%h@`% hHP%hP@%hX0%h` %hh% hp%$hx%(h%,h%0h%4h%8h%<h%@h%Dhp%Hh`%LhP%Ph@%Th0%Xh %\h%`h%dh1^PTRh h QVh0pUS[lQ t&X[ÐUS=u? -X9v&9w[]Ít&'Utt $ÐUVSòP uD$D$>4$|UT$ U D$T$FP$u5D$D$ D$D$$̡ [^]Ë$ÐUSP E$=[]ÐUWVSO uD$04$9{uD$:4$%{bD$:4$ {1D$4$zt$8D$D$ D$-E (hD$D$ D$D$$訠[^_]D$Y4$kz^D$]4$SzFD$N4$;z.D$4$#zD$4$ zD$4$yD$4$yN8t&D$Y4$yD$]4$ynD$4${yVD$O4$cy>D$N4$Ky&D$4$3yD$4$yD$4$yD$4$xD$"4$xD$4$xD$D$ D$t&D$4$xuMD$O4$lxu9D$4$XxtX} tRD$D$ D$D$N4$xuD$D$ D$^D$:4$wuEFL$*t$<$%D$UD$D$ D$T$$y1_%FPFHD$ D$"$D$D$ED$ D$J$D$Ń1EEED$]<$]MFL$gD$D$ D$]3$D$FHD$ D$;T$D$D$$1SFL$軇>D$<$\4FL$蹊D$D$ D$G=D$D$]<$E]EFL@@!tEvEUwmE1 EEu҉tVU9UiEEmUED$ D$hT$D$D$UT$$U9VXFHUD$ D$pD$D$ET$$D$蘁EUUEED$N<$P[U0FL$2D$D$ D$hFHD$ D$m$D$D$ED$EZFHUVXD$)č|$#)ċEԃUt$#T$D$ D$<$.Ut$|$T$ U؋BL$tED$|$4$tmD$D$ D$uD$$At1҉ЋUe3e[^_]Ðt&D$D$ D$o뭋E4$D$ D$ED$`xJU؋E܉t$ D$T$$Bv)D$D$ D$? D$D$ D$z fU8]! Eȉu։}EtEtSu0Mt)V8D$UE$D$]u}]ÍF4V@EF$UD$GlD$GL@@$hUD$T$UD$ ET$UD$$uD$D$ D$&F@Nt&D$D$ D$D$$0r16'UWVSE4$xP@dP@tTBQTdAHD$ D$t$D$zD$$~dTGL$}|$%D$x$SGHdD$ D$D$D$T$$d`@FR@qTxD$D$D$ |$$nd$|D$D$ D$T$$rc`P|F D$GlD$<$D$ TD$k dD$D$ D$T$$b`5T耉$MTdAHD$ D$t$D$tD$$b`uq(D$D$ D$dD$$Ab`XE8UXD$ D$dD$D$T$$a`!$EhTfzPEEEEEPQ(- 9UEu P8t P@@Euu1D$ EMTx)D$L$D$t$<$Px(vU$‰D/P}9~(xTdBHL$D$ D$OD$̑$zE|1[^_]ÍXD$D$ D$u$t$>|1[^_]ËUB8 UT$M $uF8t0}G8@@ t D$D$U$ЅD$D$Su4$}G }}uF D$}<$;FuF$E@ ED$/$譎t UEB M $&t$D$ D$n}$|$q=t$D$ D$U$T$J=1D$D$ D$E$D$=D$E$D$D$ D$D$T$D$ D$U$T$<D$M $uF8>D$D$ D$}$|$V<1D$U D$M $4ED$/$ 4D$D$ D$Hu$t$;oD$M $>D$D$ D$D$,4$vkE`D$D$ D$)E$D$P;D$IE$ED$LU$ED$D$ D$}$|$:mFD$ D$eD$D$}$|$:.UB $>MA D$ D$rD$D$u$t$L:G8@D$ D$D$D$M$L$:1c} }tKD$/<$t7|$E$y7UEBM܉$L$ՕM܋UE mJD$D$ D$U MmU AD$u4$6}GD$/UB$ 4MA&D$IE$tbD$D$IU$L[D$D$Iu4$}Gh u}pD$`D$$|EUMD$E $pu]u}]ËED$ D$F$D$vD$ lD$_,ED$ D$D$E$lj$tA<$fsD$lD$ D$J$D$+CMU MȋUĉ 0U~GXE̋Ep<$D$ED$D$E$<$G@T$L$D$ $7EZlt$D$ D$D$$+lt$D$ D$PD$$*Q, ESWDUQUG@T$L$D$ $7Elt$D$ D$D$$J*=ED$T$|$D$ @$EYlt$D$ D$D$$)WH$fD$lD$ D$T$D$)0D$lD$ D$$D$i)\Ẻ$虍QEUU(]tÞ uu}}D$94$t4D$84$%_D$D$ D$'.D$ 4$tB_D$D$ D$0}D$$(]u}]D$ 4$RuD$W4$>uD$4$*uD$X4$jD$ 4$RD$84$tcD$i4$tOD$D$ D$5%D$R4$E |$4$D$4*D$E D$D$ |$D$4$*'U]蔅þ uu}} D$14$u<$ft>D$84$uD$ 'D$D$pD$4D$0#D$,D$$D$(iD$$D$ BD$AD$;D$ D$ D$)D$D$4D$0#D$,D$e$D$(iD$$D$ BD$AD$;D$ D$ /0D$HD$DŽ$DŽ$#DŽ$D$|iD$xD$tBD$pAD$l;D$h D$dmD$`eD$\D$XD$TD$PD$L]D$HND$DYD$@[D$<-D$8"D$4D$0OD$,%D$(D$$?D$ :D$0D$2D$D$ D$C$tD$LD$D$tD$p#D$lD$i$D$hiD$dD$`BD$\AD$X;D$T D$PnD$L?D$HmD$D!D$@eD$D$ D$lD$(D$HD$D#D$@D$"$D$D$ ;D$D$DŽ$DŽ$#D$|D$xiD$tD$pBD$lAD$h;D$d D$`fD$\eD$X.D$TlD$PD$LaD$H[D$D-D$@"D$0W$}֋MEִ fEԋEmPmm}m֋EȋỦA A$Q($MA,Q0|[^_]ËMA4>E@4,؋ $]%FExZuEMăEE9t6x'}UMw]JMċEft)~1كpf9u$1]E u ؋l)D$D$T$ D$$D$T$D$ D$$F1 U}} ]^NÈ uwrD$4$FuG ]Ћu}]Í2D$4$FuG ͋E1҅t1҃4뭍t&'UEU ]UEU ]Uuu ]~Mè FD$E$gF<]u] Uuu ].MX FF4$t1҅tF ]Ћu]Í'U1}} ]uL w>@Ɖ4$莂1҅tw]Ћu}]Ít&U(]}ljupU@8Lé <+tt<-t|G4ADPu1]u}]Ðt&ED$ D$ 4$D$ >U92tƉGG G$G,W(W0몃G4닃G4|U8]UK uu tXE8uP~4tJ~~>D$$D$D$ D$$,]1u]1]u]Ít&U8]UAKk uu tXE8uP~4tJ~~>,D$$D$D$ D$w$]1u]1]u]Ít&U(]UJۚ uu }tMt%t1]u}]fyg}D$<$BuF8Ǎ7D$<$Bt܍D$<$BuF8덍fD$<$Bt܍ZD$<$pBuF8P:D$<$IBtٍ=D$<$3BtÍAD$<$BuF8CD$<$AtٍAnD$<$At1'UE U1҅t E1Ҁ8ɉÍv'UVu U\tE8t1^]1~4^]É'UWVSH D$/$V;utElPE~GhP1EEEE9Et$uD$E$3Fu׃[^_]1[^_]Í'UVS&HP FtP@D$BD$D$ D$R$D$[D$$D$ [^]ÍFD$$t$D$D$ D$N$L 1[^]ÍvUWV} t7~:E1t&U%uE9uE^_]EE^_]ÍvUWVSGA \EUe M1$xD$G$mCt$D$ D$$T$$CfD$D$ D$|$$B$;A,t$D$ D$D$$Me3 Q\[^_]ÍE Dž4u&E 9M 9FD$ 44$56t:D$D$B$8&44$;t$D$B$8BD$L$G$8t$D$ D$$D$$artD$D$B$%8t$D$ D$tD$D$G$7uZt$D$ D$O$t$D$ D$|$$NB$,u9uʋFtFt;N t+;Ft$$V FF  z щL$D$Pt$ T$D$D$ D$L$$tD$D$ D$$D$D$D$ D$$D$e\L0T$L$$(]< $S"$\D$ D$$D$ D$@D$ϣD$$D$v8 kfNƃd@t&0dPD$$^0 $*f1"01$ D$$D$D$ D$I$#Dž(ƅD$D$ T$D$$D$$Dž(pƅD$ D$D$D$뮋D$D$ D$T$$XH(D$D$ D$L$D$$ |D$4$D$ D$i#xm 4$L$~ $t$D$ D$ $D$ȣD$ϣD$$D$1D$D$ D$ $ÐU8}}]M {)åy UUutvT$L$$wƋE$*|$ t$D$D$ D$C$D$vD$D$]u}]Ít&z낐&U](x UMuƉ}$V*4$L*$ )T7DPuE]u}]ËEt&UWVSg(Ñx LPD$JE$蹣UȅD$UB<$A$1)t"$r)$F9}lj4$)uމ4$)8D$UB<$"AD$D$ D$rE$D$L[^_]Í$D$D$ D$mT$$1D$D$ D$&E$D$;$(UUcED$4$N\4$R(D$ D$|D$D$U$T$A<$H(VD$D$ Ẻ4$D$vD$JE$ԡu4$VtED$D$ D$D$4$`9E؉D$4$&MXD$E؋U܉$T$E/4$L4$4'D$ D$XD$D$E$D$#D$EU$T$EPJ<$&<$P'D$JU$蝠k1MD$T$D$D$ D$E$D$ik1D$T$D$D$ D$E$D$Pk1D$LT$D$D$ D$E$D$k1tOD$ T$D$D$ D$E$D$L[^_]É4$J/z멍zVzz4$%D$ D$SD$D$U$T$ jUSE3#]s D$E D$E$ []ÐUS$U "s Mu;pD$D$D$ D$($t$[]ÀI8dD$ED$D$ T$D$ $ǍU(]d"Îr uu }4$=uwED$?$ԝt$D$E$u5D$D$ D$D$$]Ћu}]Ít&4$h=lj$.=ohUHE ]!ûq uu}}tMD$D$ D$3>D$$]u}]D$<$D$uEFvD$/Eu$U<$T$?tyE4$D$tfU썃t$D$D$ T$D$+>D$$FGv<$EuD$ʿE썴&U$%Vu0D$D$ D$8ED$/$tRU<$T$lt=D$E$t*U썃t$D$D$ T$D$A(ED$/$btEUD$/$EtEE$UщƋ! t€uE҃+M$)}9s>D$>t$D$ D$OD$$U:u:TD$>D$ D$TD$$yzE$u:D$>D$ D$YD$$01U$0TuAED$ D$_$D$D$>D$UET$$uD$D$ D$dU썃\D$>E܉D$T$D$ D$h$lUD$ D$<$T$ E$WtBE$~rU܍D$D$ D$lT$$EUD$$jUT$@<$D$tFEfUD$ D$zD$ET$U$D$D$T$}ED$<$D$覭U$q\EUD$ D$rD$D$E܉T$$D$뗐UWVS=gl @eE1<8IPqMtOfTfN~P@D$?$WtTP}Y8PpAD$D$4$D$@D$ nD$}PwtP@PDŽPD$ $]:Ue3[^_]fdTt&8A QD|Q|mVHٍD$D$ D$c$D$衮0Wl딋U E7hD$ D$$D$ D$D$@dD$D$ D$Mt$$ MD$D$C $pi0|;NlDž\Dž<Dž80;OlP+Tl@vzp҉@1ҋv@ u Dž  1@ ҉v E 9 |0Fl9. }E0$G&tQ} U1׹ T$D$0UD$ D$$Kt Eȅ }EF}<4$5?D$D$ D$U|$$vvlupu tt0D$D$ D$$D$«019Due69D%NjF N@ (tVN 8<Dž\tF$<\(9|w|8<)\plt~l{vpk0Dž<Dž89DpX2&<t 9t:D$t$D$ D$D$$tUD$P$ǂu+u'|Dž\B$it9\ D$D$ D$t$$oD$L$D$D$ D$$|$2\D$D$ D$|ua@4$T$D$Th}t!D$(T$L$D$D$ D$\|$$蘧}0|Ql9$l'D$D$ D$n$L$,U1׹ T$D$0UD$ D$$E|EE9M}YE$6D$D$ D$O3ED$D$ D$=t$$?04$t4$ 00GL$?|$%D$E$$@hD$ D$yD$FT$D$$袥 $U4$1)Ћ4D$t$D$ t$(D$p|$$D$D$D$ l $D$xD$D$D$ D$h70Bl+|$D$YD$D$ D$`|$$衤<$^_.D$D$ D$$D$V0BL$U=0uL$4$%D$U<$轨kpED$|$$PD$ D$D$_D$$$$Q||*0L$L$D$D$ D$/+M/D$@D$ $uD$4$pD$PD$ D$$|$D$CD$|UE$ D$D$ D$IT$$蝢hD$ D$iD$$D$t$$^D$D$ D$B}|g@D$ET$$NuuzT$D$dD$D$ T$D$t$ǡD$D$ D$vL$$藡uD$?4$d{tfEt&D$$'bhD$D$ D$bL$$hD$$;|$D$E$M}t{ED$<$F\$FD$ED$ D$T$D$"D$D$~}uF1}<[^_]ÍD$D$D$ D$M$/1<[^_]Ðt&\$FD$ED$ D$W$[UWVS J@ $teE19tD$$Ek+tD$k$bkEE44$(ftVUD$D$ D$WT$11D$$Ue3 Ĭ[^_]Ët@D$pD$ D$?$D$辌U$.$tQUB$@ uEUT$@D$ D$mD$D$p1$D$^EE$$S8UD$pD$ D${T$D$$UtD$ D$D$T$$]& UTD$D$ D$T$p1$D$茋x1B0pD$ D$D$ET$$D$D$AU$#EpD$ D$tD$ D$T$$EUD$ D$D$T$D$EED$ D$ND$`D$p1$T$肊U$[ED$ D$D$D$뭋UET$t|D$B$UEUD$ D$D$hT$D$zED$ D$ID$,D$0EuD$@t$$WFp1D$D$ D$T$$vtD$t$$xED$ D$dD$`D$xB0pD$ D$DD$ET$$D$D$UD$pD$ D$T$D$$豈UbL|EpD$ D$D$|D$T$$nEHL9Ept$D$ D$wD$T$D$$'E$U$ EE$ U$E EE$ ׋UƉ$ UBhEB$@B(tD$ D$D$T$$ "t+UEr\B(Ez`BhEBXEBd=UD$D$ D$T$t&'UX]EaË5 u}D$k$`UD$$E`MD$ $`D$fƋE$`MԍtBD$D$ D$1D$$胆]u}]ËED$1$>`u#} uD$D$ D$랋UD$1$`t&u t&@D$D$ D$aM u1D$ỦT$D$ D$$M $tVD$ED$ D$$D$~1pD$D$ D$M̉L$$AU MEEEEEB$tUЉ$.VE1ɉEE܃EE 9EU؋MEЋ<$UЋMD$D$D$ T$|$ $,rD$Ẻ|$D$ D$D$$Zn09bEEV1ɋEE<6E9uEz+E܃tk1}k1L$ M̉T$U܉D$D$D$ T$D$"L$$較E9E&M $pu=D$ED$ D$$D$h|z\UD$D$D$ D$|$$*%M̍|$D$D$ D$ L$$1EEUWVS,E +1 }T1E`ED$ D$ $D$ED$ED$iED$D$ D$ $]D$T$ D$E$ &;u u,[^_]ÐUWVSGq0 EueU1҉dE\$|D$4$[tD$g4$[D$g4$t[ta} t[D$D$ D$(-D$$ZDžhUe3hļ[^_]D$g4$ZDžpD$4$ZzD$D$4$;[D$4$ED$|lEЋlD$$=$_<$U؉EA<$EVl$E3D$D$4$\D$D$ D$4$[D$4$EUYtE\d4$T$ U D$T$\RzE Džho<1`5`D$4$D$npg8;} f*`D$$4$T$n\dD$4$D$ {uD$-D$ D$gD$$DžhGzD$}D$g4$3Y<$pD$N_}hD$D$ D$#"D$g4$bX{o8D$-D$ D$bD$$E~DžhED$ D$8$D$D$-D$}ED$ D$=$D$pD$D$-D$}DžhZ5D$-D$ D$GD$$u}DžhU8]þ+ uu}}D$94$Wt4D$84$VD_D$D$ D$b.D$ 4$VtB_D$D$ D$lVD$$|]u}]D$14$rVuD$ 4$^VuD$W4$JVuD$4$6VjD$X4$VRD$ 4$V:D$84$U~D$R4$Utj|D$D$ D$q vD$R4$UD$d4$UE |$4$D$CTD$E D$D$D$D$ |$D$4$ dUWVSwá) ,E$A#UE$u M WU EUE$lU$yƉD$dU$Tt$|$E$'D$U荃D$VD$ D$>T$D$$gzUtD$ED$U$iE ,[^_]ÐE$U$NjE)1$*E$U$aD$8E$StU$BFED$ED$U$9D$RE$\S U$it&E$,,[^_]Ét$|$E$&D$U荃D$VD$ D$HT$D$$xU$}D$ED$ D$D$D$D$VD$xE$2ED$ E,D$UT$E$k[E$@tLU썃bD$VD$D$ T$D$"$0xE$u+UT$E$.t @EUB0D$ED$ D$.$D$D$VD$wMU8]& ҉}׉uEtD x]u}]Ít&D$EE$t~t5FH t+1ҍE!ЉD$ED$$хt t&{st&tEuM1ǃD T&D$&D$ D$!D$$vǃD &U(]$ u։}t$<$D$ D$`]u}]Ít&U(]dÎ$ uu }}t$<$$ct$]u‰}]c/D$&t$D$D$ D$O$u]1u}]U]# ɉu։}t>BL$t$<$%D$d]u}]Ít&BL$Et$<$%D$SdU]Dn# uƉ$ 1t/1҅‹]Ћu]ÍU8]# uu}׉E4$ED$ D$D$ D$|$$wu1]u}]Ít&Et$ D$ |$$ſt΋U9tB`P9u벍vUWVSGq" ,u}-uI(D$D$ D$&D$$sEE,[^_]Í&E $8]U4$T$nf&EUGL$k |$4$%D$ybE $-GL$# |$4$%D$1bU4$T$fGL$ |$4$%D$aLD$D$ D$4u$t$xr<$MXD$D$ D$6t$$>rEfXD$D$ D$ BXD$D$ D$U$T$qE $H!GL$ |$4$%D$`U4$T$eEE,[^_]ÍD$D$ D$U$T$]qE D$D$ D$T$$'qED$D$ D$;t$$pU $66tE $+tE $xuXD$D$ D$>U$T$pEGHD$ D$0D$D$E$D$VpEGHD$ D$&D$D$E$D$pE!v'UWVS7a ,}U uED$&D$ D$5ED$$oU $4u91D$D$ D$7E$D$ho,[^_]ËU<$T$?bGU $*xUBL$%%D$E<$D$0^E<$D$b f1D$D$ D$U$T$n&UBL$%D$E<$D$]U<$T$0bU $t$D$ D$GE1$D$nBfE 1$cD$D$ D$>U$T$mE $er,[^_]ËMUA1ōD$D$ D$ME$D$XmE<$D$1aE 1$gt$D$ D$EE$D$mD$D$ D$eU$T$lUBL$%D$E<$D$[UtU$ҫV0D$D$ D$oE$D$MlU<$T$.`D$D$ D$s&U1BHD$ D$yD$D$E$D$kU<$T$_UBL$%D$E<$D$Z8D$D$ D$PU$T$[kD$D$ D$RU$T$)kE $i0U $%'US)S $D$ D$iD$H D$ED$ E D$E$Q$[]Ít&'U1҉] }}uuuD D$D$ D$p&D$$+j]u}]ËU ED$:E$U+ET$D$G$EoD$D$ D$|dE UԃEU$E D$ D$Eԉ$EHUD$ED$ D$T$D$$3iEuEЅt-UlD$D$ D$T$$hEUԉ<$D$T$E M1U(EU<$D$T$ ZiU$D$<$D$WEԉ$D$4<$`BU<$T$D$]D$<$Bu‹<$EED$>UEID$S<$AE|D$S<$$BU$EfD$/EEЉ$輶.UD$<$T$A`E8/u EE8/tUD$/$vU$#U$ED$ED$uEEEЀ8/&D$D$ D$NUT$$gUED$D$ D$T$$fUED$ D$T$D$$fvEUc8UED$D$ D$T$$ cUЍ$D$&D$ D$T$ED$$bUEUD$<$D$ EԉT$D$EUT$D$ D$D$$ZbTt&Eԉ$%jEUT$D$ D$D$$ bD$D$ D$TEԃXD$G$?EEUT$D$ D$D$$aUԍD$ D$D$T$$蚀EEHP`D$G$~EUĉU$%EԋUE@``U9ЉEE4$fFPf7@t&FHD$ D$D$D$E$D$`EEU9ЉEEp9utEЅtFHUЉ$T$duE4$1FHD$ D$D$pD$nUEċRlD$U؋U܋D$ t$<$D$ED$íUE9Bl=FHNP@D$FL@0D$Bl+E؋UD$ D$D$D$T$$m_MЅEЋUD$ D$D$D$T$$)_EEUD$ D$D$T$$^FHD$ D$D$D$U$T$^E2D$ED$ D$$D$^UVUED$D$ D$pT$$F^UDD$D$ D$T$$^EEUT$D$ D$D$$]UED$ D$T$D$$]FHD$ D$D$D$uURluyEt-D$ED$ D$$D$8]UԋB0D$ D$$D$D$ED$]UEȋUD$ D$D$ET$D$D$ D$D$<$UD$D$ D$T$$y\UED$D$ D$T$$I\$FHD$ D$D$D$E<$D$rBU<D$D$ D$T$$[UED$D$ D$ T$$[UhU ]ѹ u҉}uGdD$D$ D$"D$$O[EE؋]u}]ËED$m$5E E~Ǎ"EЍPU1B0D$M̍<D$D$ D$PL$D$$OM̍D$D$ D$hL$YD$t$U$>M̍`D$D$ D$5L$EĉD$$zOM܍1A0D$ED$ D$HT$D$D$$2OM܉ $rfU؉$}u9rVw9fvNM1 $D$T$ED$ D$}D$dD$U$T$NVU܋M؅҉qPyT $d)ƋE׉pPxT$M܋I@D$ $T$L$xGE1$ D$U̍D$D$ D$T$M$L$NE؉$D$T$ỦD$D$ D$T$M$L$MED$ D$D$D$U$T$MM؉ $$E܉$tU܉$/>M1A0D$ED$ D$D$D$U$T$MD$E܉D$U؉$1D$D$ D$M$L$LfD$ D$D$E؉D$U$&t>U̍D$D$ D$T$M$L$YLM̍T1D$D$ D$L$E$D$LM܉ $PwUWVS7al}eE1hD$V<$%tdD$<<$%tP4D$]D$D$ D$v$kKMe3 l[^_]D$<<$%D$<<$%fu]XT$D$D$ D$}L$$JD$$D$<$9u_D$D$ D$T$$JD$V<$K$]t#G<$D$<$;D$D$ D$L$$ J<$8uYD$<$D$9D$D$ D$T$$I?0w9DžDžDžDžDžDž:$uK$訥9@D$<<$"uD$V<$"t $Mt$4t@ $;$!D$B $1hƋ9tYN $!$赜;~ $o$蓜h;~69uh90((E\ $xD$ D$"$D$j1D$D$$G9R $D$D$ɖD$D$$論D$D$$荖D$d<$q #D$i<$Y D$D$$G $$D$f<$ t]D$@D$$?JD$D$ D$7L$$E$D$D$ $D$j1D$ 4$ $<$T$D$DQ$ottJhD$(rtL$$D$ L$D$D$ D$FL$D$D$$D$$QVT$D$ $D$L$r$r $.+<$T$D$6 $"$<$T$D$ L$$T$D$ D$D$ D$T$D$D$D$C$T$D$D$D$D$D$ $D$D$ D$T$$'CD$<$L$M2$D$D$ $D$j1D$ e$$ $W+<$T$D$_$K$<$T$D$)Q$ottJL$$D$(T$,hL$ L$D$D$ D$`L$D$D$$A<$T$D$<$+D$T$V<$T$L$8t$ D$ L$(T$$D$(D$+L$D$T$D$$@D$<$T$0hDžDžDžDžDžDžYUWVS赞lUMD$4$D$uEԍD$D$4$uE؍D$D$4$uE܍rtD$D$4$vEЍ%D$D$4$duE5D$D$4$GuE䍃CD$D$4$*uEE EE w EED$W4$zD$D$W4${ D$ |$D$ D$9D$$>l[^_]EEw D$ D$4$uED$i4$q D$ D$4$]uEt&D<+v}̍&UD$X4$T$EED$4$D$oD$4$!ED$ 4$tED$ 4$D$ 4$!ED$&4$ztEED$'4$X!ED$(4$@tEUT$(ED$$UT$ E܉D$U؉T$EԍU|$T$ D$ED$Ủ4$T$:D$ D$D$ D$c$<l[^_]ÐEEB D$ D$4$sEuu}} D$14$ u<$蔪tdD$ E|$4$D$.‹]Ћu}]Í'U8]蔎þ}}u<$t <$t}u EE|$ D$D$D$t$$EtEUD$D$$E ]u}]ËE x<$+UD$ $EG,D$ED$gƉ$=ED$ D$$D$bD$ D$)/4$q_fD$ D$ D$D$$.v4$(<$4$D$txV0<$UUD$ D$$T$D$D$ D$e.wUVS蘌 uED$D$D$ D$t$$u<D$ D$D$ D$$- [^]É4$7ꐐUS#E$c[]ÐUE]@0ÍvUHE ]豋u}uAdD$D$ D$D$$/-1ҋ]Ћu}]ËED$m$MD$m $UMBl $D$?UMBhD$D$ $f}D$D$D$ D$'D$$u,1AUD$?$;PD$D$ D$t&ED$D$ D$ $]MQ,UA(B@ &MD$ $t$ED$D$$rTUD$n$UD$D$)$MD$D$ D$) $ƋE׉p P tHUBTRXEU t5EUt$|$ $T$V =UB BMD$D$* $:%ED$D$ D$*$^MAQ tMyXqT dUD$D$$MD$D$ D$ $MA Q$ ED$D$$UBMD$D$ $n_UBD$$uMD$ $t]D$D$ D$4?\D$D$ D$H D$D$ D$:ED$)$uUD$*$ lMnD$D$n $Rp)u Qq)‹E-(D$D$ D$BgD$D$ D$UHD$D$ D$[)D$D$ D$g D$ED$$]UB J$D$LD$D$t$|$ T$D$ D$b$'E@@FEUt$|$D$D$T$ D$ D$PD$$'x&'U(uu ]}蛅FQ umFQ@FR@tNFHD$ D$ $D$D$D$'ED$t$$]u}]f4$jtD$D$D$ D$D$$&ED$|$$藻?f4$j+D$D$D$ D$뚍&'UU ]qÛuut?B@FBPFBLF BEEEDPE $EȍUTUU[L$D$D$ D$AD$D$ D$D$$nL1[^_]ÍD$D$ D$ ċU؉$T$U܋EMt$D$ D$|$$?\L$D$D$ D$p<:SD$T$D$D$ D$|$$'UWVSyDžHoD$1uKD$D$ D$QD$$DžLLHDD$B<$艆DžL\\$nt~<$enD$D$D$ D$D$D$õtj8D$DD$T$ $49L}Ln\$nLDžHlD$D$4$]E$ZE$Z}EQ+;HD$D$ D$VD$$k yUWVSký,ET$D$ D$$vD$ED$ Et$|$D$ E$Ɖ$躤4$誤tjD$ED$ D$$D$ E4$iuED$|$$4$ƿE,[^_]EtfE$Q]t"Et$|$D$ E$U;E~E뎋E |$$@huˍFhD$E$haUWVS7jaLuEEEEEEu4$dt E U EUЍ~t<$\u~vt9E t&69t,Et$D$ UЉT$E$U9E}E"t΋EȅtD$UȉT$E$]E t;ẼL[^_]ËED$D$ E؉D$U$UẼE띋UЉ$ ẼL[^_]É4$=4$=ED$ D$D$E${EЉ$PtNUЉ$ED$ D$g$D$bD$D$: E4$FD$UЉ$7ut4$+UD$ D$q$T$D$D$D$ D$EȉD$U$EЉ$Ep&UWVSg,} D$<$虼utE$FZEt1EMtE$&ZEtE u}Epw``EE9ut&69F@Qu$uUuk}fuHEEucEtED$FD$E$U9E}EUtE܃,[^_]ËFD$E$?etEEtF@HD$E$HdtED$1E$F69#EtE$a;EmD$D$ D$D$$}3EE܃,[^_]ÍGhD$E$pdvEjUWVSe/E܉|$4$D$auU܍<?/}<$[|$4$D$auEEt U<$[ƀ>/u6t&>/t<[^_]Ã>/tp}t E<[^_]ËEtE?/u?/tED$ED$ ED$|$UB$|WtE8t@ D$|$D$D$ D$8$<[^_]ËE$ZƋE$ZDED$UB$`tFU썋o:uzT$ƉL$ED$ lD$E4$D$\aD$D$ D$@D$$GfUWVSu} D$UccÍ4$D$UB D$H4$D$UG BD$Z4$D$UGBD$4$D$UGBD$a4$D$GD$74$gUnRD$D$74$n)ty1GD$D$a4$|D$D$H4$dD$D$Z4$C1҃[^_]Qo)upF Gfv<D$D$ D$D$$p[^_]ÐhD$D$ D$뾍t&D$D$ D$랍t&U(]Ta~}}u{$R1҅t;D$D$<${D$/$Qu%t$G$Z‹]Ћu}]Ðt&D$t$D$ D$hD$$l1봐&UWVSu `ûE D$/$*Q} ?/u4$Vt$<$ED$\?/*D$/<$Pu 8/tD$/$PE D$ D$@D$D$1D$$v[^_]}?/{?/tnE$(űM tŋU D$D$ D$QT$D$$f8/txvU|$B$Yt>D$/$OEU D$D$ D$5T$D$D$ D$FD$$eUWVS^LEEЉ$:MUỦ$,MEȋE E-D$ED$ D$ $D$UD$$E$PU9UUuE܋9EEE܋ptUt$B$[t͉$轖uEU؉D$ET$UD$ ẺT$UЉD$E$E t3D$ED$ D$ $D$E؃L[^_]ÍDD$D$ D$T$$} EEUt$D$$&D$/$pMt$D$D$ D$E$D$;}EEU 9UEԋU4>@o~<$u t$D$D$ D$돋U|$B$UUD$EЉD$B$[u.D$D$ D$E$D$Et&Ut$B$UUD$ẺD$B$u[.D$D$ D$EUЉ$ Nu;uu6;u~<$4uE1ɋUD$ET$UD$EЉT$ Ủ$ET$KEtv'UWVSZEE$gIU؉U$YIE EMDD$D$ D$U$T$D$M $BE$LME 9MUUEU9ЉEMIM $u؋ED$D$ UT$M $sE$HE$赮}+UbD$D$ D$&T$M$L$'EOD$D$ D$E$D$EČ[^_]ËM $GE؋UE9uH#vU$qOD$Mlj4$L$LUu E)9tUME 9MMqD$/4$fIEuE4$D$pVuU$AG1ED$UB$RRD$ML$UB$=Xr.D$D$ D$=E$D$D$UT$M $E$E&EUT$MD$ L$ED$UT$M $D$ƋED$U$M $蛬9u}ujCD$D$ D$)E$D$2lD$L$D$ D$$UЉU$EE EEMEE4>@ZED$t$E$E8/~D$/U$[G8/u?/tML$E$EpML$UB$BPD$ML$UB$-VE$L<$LDED$UB$R |$MzD$L$ E4$D$ Ot$ML$UB$UEE 9EM $IHUUS~<$?t$D$D$ D$U$T$댋UMD$ D$D$D$E$D$}HE<|$MA$ND$ED$UB$T .D$D$ D$M$L$DEJEt1U$t}EML$UB$'ND$ML$UB$Tr.D$D$ D$d}DaD$D$ D$U$T$EEČ[^_]Í.D$D$ D$뼍.D$D$ D$ EUVSXSÂ0$E\D$ED$ED$ D$E D$E$hƋE$F$诂0[^]ÍUWVSR,uD$>4$YE@0E4$D$>4$mPUJED$@,<$D$D$D$ D$AE$D$,[^_]Ít&U$蕋D$D$ D$Gt$$D$D$ D$Ht$$b,[^_]Ðt&D$ED$$CEK}Et$D$ D$D$D$<$NE0tD$|$4$}M4$DUED$4$E$I!D$D$D$ D$O$a<t$D$D$ D$!U$T$&<$JDD$D$ D$<U$T$,[^_]ÍE뻍D$D$ D$U$T$댍dD$D$ D$'U$T$}<$CRUE D$ D$TD$D$E$D$3U(]TO~} uu}t]D$K4$LD$D$ D$D$$]u}]ÍvED$4$D$'lj$荄uU(|$D$D$ D$D$$ED$>14$ ?D$K4$D$>4$zD$D$>4$:4$D$„Ҹ D$D$D$ D$*$D$$|$4$u9|$D$D$ D$1|$4$h4$t}zD$D$>4$|$4$D$Pt]ED$4$D$D$|$4$D$D$ D$Cb|$4$럍D$D$|$D$ D$G$ED$4$D$D$|$4$UWVSKlED$0$iD$GEE$SD$ZEE$=D$lEE$'D$EE$D$EE$D$fEE$D$aEċE$D$7ƋE$D$NjE$D$"EȋE$D$E̋E$yUUUUUUUUU̍u=D$D$ D$D$$Cl[^_]ËED$0$D$GEЋE$D$ZEԋE$D$lE؋E$D$E܋E$D$EE$D$EE$D$fEE$iD$7EE$SD$aEE$=UUUUUUUUUvLD$D$ D$+ED$$t6ED$0$uD$D$ D$1uED$0$tRED$0$D$j҉D$ET$ D$E D$E$ &ED$2$1tD$D$ D$7&'UWVS\z``NHxEM9׉UEtiEЉEEwD$D$ D$Et$$Èt/FQ u)EЅt"Et$D$E$|]t&?;}uE\[^_]Í&'U8]GΗu}ωEUD$L$$uD D$D$D$ D$$]u}]fUB@ u>B0D$ D$$D$D$D$륋E$yu:D$D$ D$D$$e\tbEt$h$EUB0t$D$ D$D$HD$D$$EUt$hD$B$Fu*UB0t$D$ D$D$ D$떋E$uD$D$ D$U$AtҋE$UB0D$ D$$D$xD$D$(&'UX]EAEk}}uu Ẻ<$tKt$D$D$ D$D$$EEЋ]u}]wT$D$"Ẻ$$"uD$0Ủ$/OÈH8D$D$0$(E׃UE U։EUk<$<$DŽ…ҍEW`G`E9‰UEEEU9ЉE Ur4$_tFQuՉ4$f_uFPu}t FQ t&uE}}KFL$[~t$%D$Ủ$f^}t}t&t FP @E8D$"Ẻ$ž<$襃YED$%Ủ$莾 <$ԃUȅD$G0D$ D$$D$D$D$HED$lỦ$ 0pD$D$lẺ$dn)u Qo)…<$|XG0D$ D$D$D$U؅tQ}G0uD$E܉T$D$ D$lD$`D$U$T$IE9EEIw0<$D$ t$D$D$D$U$T$ND$GỦ$込D$D$GẺ$軽<${D$D$ D$#D$$ys sE/rzuVT$G0t$D$ D$zD$D$D$$EJEG0T$D$ D$D$D$UȉT$$Nrt&;rE_(rzuVT$G0t$D$ D$D$ D$E$D$,C<$/zG0D$ D$D$$D$1D$ZỦ$辺t}D$D$ZẺ$迻D$D$ZỦ$PD$D$ D$>D$$iED$Ẻ$*u D$Ủ$Ẻ]u}]4$sYuq}tk}t&FL$x%D$t$Ẻ$FL$x%FL$x%뢉<$G!D$D$ D$D$aẺ$ tWD$D$aỦ$n<D$D$ D$]gt$Ủ$gD$fẺ$蟸<$}D$D$ D$D$$wEFL$pwt$%D$Ủ${s t$<$rD$D$ D$(l<$hD$D$ D$C=D$Ẻ$虷D$D$Ủ$薸<$luND$D$ D$<$豢#D$D$ D$-;w<V4$wD$ D$D$D$D$$EFD$7Ẻ$趶&D$Ẻ$蛶 G0D$ D$t$D$D$$||$Ủ$mD$D$ D$t$$;<$<$G0D$ D$3$D$xD$D$E8t$<$|D$D$ D$pD$D$7Ủ$n)u Qo)…<$fttUG0D$ D$D$,D$ <$sD$D$ D$m<$D$D$ D$ ><$suċG0D$ D$D$TD$<$bo<$2G0D$ D$D$xD$D$$Kyt$<$J<$zD$D$ D$tD$D$aẺ$;G@*<$D$D$ D$j<$uND$D$ D$t$<${uTD$D$ D$Hw4$uUG0D$ D$D$D$_<$gD$D$ D$MaO`W`U9t8QFBFBF B FBFBFBFB 9Muȉ<$D$D$ D$<$D]<$G0D$ D$SD$xD$O8<$z:D$D$ D$tt$<$GD$D$ D$oD$$ED$D$Ủ$|D$G0D$ D$e$D$xD$D$aE<$蝜D$D$ D$t<$<$G0D$ D$D$xD$<$谑<$G0D$ D$D$xD$Ig8o<$i<$9G0D$ D$D$xD$<$+<$G0D$ D$zD$xD$USY4Ã$D$D$ {D$ED$E D$E${$[]Ðt&U(]4.uuD$4$ֈuAD$D$ D$D$$r]Ћu]É4$ u㍃D$D$ D$묐U}} E]eU1L3vuu4uRD$D$ D$b D$$Ue3]u}]Ë4D$8$dtD$D$ D$(늃@}<<$G<@|$ D$4T$$衦tXP4$D$ǭ84t$ht$P$u4t$$tFhD$4$Ɖ$dk4$Tk=tLhD$ D$>$D$m D$b D$C4$苆rhD$ D$<$D$`D$b D$벋l4$D$3{u24$'h4D$D$$t4$D$tp4$D$%ttx4$D$st|4$D$ir4'U]*z}}uuD$<$uBD$ D$D$ D$$$)]u}]ËGV9uEBD$ D$*$D$E D$ D$ D$B EEED$D$4$u:D$ D$D$ D$0$\.D$D$ D$4$U ‰Eu%D$D$4$EUD$D$4$蛥EyD$D$4$ZE<$uAM $!D$D$ D$EL$ D$$VO@ VB uGLuGLGPuGP@ B  \txW`O`l9ʉUusMl 9MVUB$u؋UB@HD$ D$YD$H!D$" \OXGXE9MUE`s&E$b|Ux$~q|xD$ D$L$\T$D$<"D$hL$$E$a$U$ qhD$ D$$L$D$"D$D$D$ D$ 4$4$D$ `T$UD$T$cM $pD$ D$$D$"D$hD$.UME9ʉUvMIM $`EEU$`U$`` $E$`U$p`M $t,`M`D$D$L$4MT$8UD$ D$L$,tT$0pD$4$L$$MT$(UL$ MT$L$xEE$Bo\D$ D$$T$D$!D$U\!D$D$ D$L$$VB  \G`W`U9ЉEEEU9ЉEE@@QEuމ$=~ϋUED$D$ D$T$4$et Eą(U$ IMD$AL $D$TqVMf\D$D$ D$rL$$lM $mD$ D$$D$"D$\D$Q\!D$D$ D$T$$!M $,mD$ D$$D$x"D$hD$h!D$D$ D$T$$zE \D$ D$D$#D$dT$$a<$dD#M D$dD$ D$L$D$$d!D$D$ D$T$$MAHD$ D$h$D$!D$\D$E/ \7StKFM @L$D$ D$D$p#D$d$D$BFU d@T$L$D$ D$#D$D$$|$4$;uqE dD$ D$D$#D$T$$d!D$D$ D$L$$R$M D$\D$ D$L$D$$?<$ U(]T ~puu}} D$94$Лt4D$84$輛4_D$D$ D$;.D$ 4$舛tB_D$D$ D$D'$D$$t]u}]D$ 4$2uD$W4$uD$4$ uD$X4$jD$ 4$ޚRD$84$ƚ~D$34$覚tjt$D$D$ D$NvD$34$pD$d4$XE|$4$D$D$ED$D$ |$D$4$˿D$d4$0L$D$D$ D$Ie U(]>nuu}}D$4$rD$8<$耙t4$d_]u}]fD$d<$Pu,4$DmD$i<$4u4$벍4$8l뢉4$Y|D$D$ D$D$t$<$p3$D$'$D$D$ D$+$оD$ D$t$D$<$ʦUU(}} ]luuu0D$14$Lur$D$D$ D$:.D$14$tB$D$D$ D$?`%D$$]u}]ÍԓD$ED$D$ |$D$4$ič&UVS"l u4$r\tCE D$ D$$D$%D$`%D$g [^]É4$3u7D$D$ D$!`%D$$붋VXNXN89t BHL9u4$EuD$D$ D$+렉4$wt؉4$qF0D$ D$/$D$8%D$`%D$芼U}} E]eU1juuduTl%D$D$ D$,&D$$Ue3n]u}]D$D$d$tdD$$h蘕tD$D$ D$%kEp`$s`p|$T$ dD$$͍6h,&D$ D$-t$D$%D$$ hdD$ D$T$$裤l$RtGl$nt$D$D$ D$1$蔺d.D$14$蜑tB$D$D$ D$C&D$$舷]u}]ÍTD$ED$D$ |$D$4$č&U(]tÞeuu}} 4$(PuF8&|$D$D$ D$&D$$]u}]É4$Ot \&|$D$D$ D$ 묉4$zu7D$D$ D$%&D$$f넋VXNXf89t B`L9u4${uD$D$ D$/렉4$pt؉4$踺F0D$ D$3$D$&D$&D$ѵU(]d}lju։T$D$ D$%D$'D$$nt$D$ D$<$Ɖ$Mu]u}]É4$1{h'UWVSEUKuce M1Ƀ} xtU&D$'D$ D$D$$赴EMe3 Eļ[^_]ËtD$x $D$E|E ~'EhpvTUx\E|x@EEMExL$D$$2:phD$ D$KL$D$$蕳E\|xD$T$ $誢E$fUxD$T$ $肢E$f&9u}uEU 9UjMtD$xD$ $蒫ED$|$U&hD$D$ T$D$(L$$蘲cvU$etM $VpD$ D$PD$h$T$9EUxD$T$ $QE$Ve|xD$T$ $&E$+e|xEUxEEhpD$ D$DT$D$$e|xD$L$$腠U$dphD$ D$2D$T$$phD$ D$7L$D$$ưUxD$T$ $E$ciMD$A0D$$轟ExX>t&UErXX$t$MxvA0D$B$fF(<$+tUMATJ`BT`U9щMEU``dUMz`;dA lv?9dwl t$ $~t։4$>`D$@4$D$}`hT$G@HD$ D$tL$D$'D$$0[EU9ЉE"MA`D$E$d $tUMB@D$A$UB$t͋MUhADBDAHBH8'D$D$ D$t$$rM $stE$(ipt$D$ D$T$$!phD$ D$>T$L$$Gh@HD$ D$lL$D$ 'D$$裭 pD$ D$qD$+ U`dnM $ UMB0D$A0D$ D$$D$\'D$hD${U(]D n[uuD$4$Iu?D$'D$D$ D$&$責]u]Í$D$ED$D$ !4$D$E D$ĐU(] Zuu}} D$4$ t<$$&fu^|$4$Hu5D$D$ D$'D$$]Ћu}]Ðt&|$4$$uD$D$ D$륐UuƉ]eE1 Y~T}׉MGUD$@UT$$zyuVD$.D$D$ D$$1Ue3 ]u}]Í&F0.UT$D$ D$ED$$D$'D$诪WJhU1uF0UD$ D$$D$ET$$D$(D$]1B'D$.D$D$ D$$ 1Bd)FHBd)FDnT<$}fUWVSlEBHUMBXD$BL@0D$ D$<D$T(D$.ED$$菩U$#UBtUUt9ЉU}U4$#UBL@0D$FHD$ D$`D$>.D$E$D$4$GE19EUxЅɋw,uy8hG(@L$A%D$G(D$E$˗*G(@HD$ D$XD$#.D$E$D$L1DED$D$ D$UT$E$Gt\uЅtUE$& D$ UB$$UPD$E$l[^_]ËU$a>$ uUBL@0D$BHD$ D$~D$>.D$E$D$dU$uOD$D$ D$t&D$D$ D$^U$T$1҃l[^_]ÍD$D$ D$bE$D$ʦl1[^_]ËE$ -UBHD$F(@HD$ D$CD$(D$E$D$h6t*v(uD$D$ D$tF(@L$7?%D$F(D$U$?uF(@HD$ D$GD$#.D$sX.D$D$ D$wE$D$襥1&'U]ESu}} D$$=&6 EuD(D$D$ D$.D$$]u}]ÅEu"}tm.D$D$ D$몋MD$ $~uE~wUD$1$~K`)D$D$ D$Nu)D$D$ D$.fD$$I,MD$D$E$Ŝu.D$ D$UT$ED$vD$$}UED$ D$$D$yE$~;VM $j;BU$V;R}M $9;uE$z:E$VM)UD$D$ L$T$D$$UED$ D$$D$豌E$:WM $:CE$:/D$D$ D$U$T$脢E$Y1UMD$T$ $蟑E$U7D$D$ D$E$D$뗋ED$1${0)D$D$ D$v$0MI8MD$ $TD$D$ D$6RM $\D$D$ D$ })D$D$ D$M $8ED$$zD$D$ D$BUļMt$D$D$D$D$T$ |$ $bUD$?$hzZEMMMM`EEUEB`;EM@Eȃ耉E9G EEut&EU؃E 9W EGT8u@pt4$_8tFNtŋED$$yt UBRt,EMUȉ$EE*yBHMD$ D$D$*D$L$$UE9?;}M9MuȉUUEr`׃`9E v69tFF@St@HD$ D$$D$+D$ED$轞E봋MUJ8MA0D$ D$$D$+D$ED$kU,D$D$ D$T$$>Md,D$D$ D$L$$EpXǃX9ua69t[FP t@NtEtE1ɉ7uӋMD$D$ D$L$$覝EU$btM $UXYEUD$ D$(D$l*D$T$$DU)MD$D$ T$D$ L$$}Mt$D$ D$L$$Ԝt$D$ D$"uMQXσX92u Z9tTƋBH t@NtE1u؋Mt$D$ D$L$$HoE$4EM $Ġ}EfUD$ D$/D$,D$T$$ћH<*D$D$ D$E$D$虛UD$M $D$uD$ D$$ED$vD$.ED$5UU$u`uBMA0D$ D$D$l*D$E$D$ *uUMT$ $贍t`M $UUMB0L$D$ D$D$*D$$pE$IEt$D$ D$D$$3U$IO)0UR`9UUMA$0E‹@ @ J ɉMtzE1E;EEtR;uutD֋MQT:u@;Bu݋E$UMT$ $pm벋E EU9P wMAD9‰UM6vUĹ}B pUMċBD 9MoEċUMp T$$S9uUMB@HD$A0D$ D$&$D$*D$ED$蛘_Et$D$ D$D$$iM 9MMO'u;uuǍ+EFUM@HT$L$D$ D$D$\$F@L$0%D$FD$E$uBFU@HD$ D$`T$D$#.D$$腗Mԉ $;}}t =u;u+>.VBL@0D$BH|$D$ D$oD$E$D$FU@H$D$腌tF$FtE6;uuUMT$ $Ċ*D$D$ D$Ut$D$ D$sT$$耖UMB@HD$A0D$ D$,$D$+D$ED$7UMD$ D$T$ $ U$Q[U$PtruEMPE$EUt$D$ D$LT$$蓕ME9A 1FMA0D$ D$@$D$`+D$ED$;U$DWMA0D$ D$:D$8+D$Et$D$ D$6D$$ՔUH].Cuu}4$<4$-tK,D$.|$D$ D$D$$iEE]u}]ËE xTuD@0|$D$ D$D$,D$.D$$E룋UMu;.D$R/D$D$ D$F$$[]ÀI8D$ED$D$ T$D$ $xǍU8].>uu}} D$4$BuDD$D$ D$R/D$$l]Ћu}]É4$MD$?EE$iU҉Euk4$@&E|$D$.$)]/D$R/|$D$ D$*D$$ǎVEt$D$E$'uD$D$ D$/4$uXD$D$ D$5D$.D$R/D$ D$%D$$%4$(D$D$ D$:iU(]><uƉ}׉T$D$ D$/|/D$0ED$$苍|$4$=tP=t]Ћu}]Í/|$D$D$ D$:E$D$.1뼍0|$D$D$ D$4ɍv'U(]4^;u}׉L$T$ED$ $vƉ$$u4$+uK]u}]É4$1?D$0D$ D$D$$e뵋ED$|$${4$1?/D$0|$D$ D$#D$$['U]E.X:eU1҃} }}utR/D$0D$D$ D$$蛋Ue3]u}]ËpD$<$D$D$t$<$<$D$D$蚠0u?D$D$ D$$D$JkT$D$ D$WD$\D$$觊D$<$D$}9Džv9BtىD$$ktÉ$[!u4$D$uDž뇍 0D$D$ D$[$D$觉$FUЉ$D$kY$1T$$g4 9Džt>$ݐKD$<$D$ xD$<$T$w$;D$G$kjCN&Dž&D$<$T$Vw$X;D$<$T$.wD$ D$gD$@0D$T$$诇D$B0D$$v<$T$D$o=8'D$D$ D$$D$?$L4$Ast$T$P$D$ D$D$gt$D$T$ D$D$4$1 t$ $<$T$D$<$D$|uD$<$T$bu$d9D$ D$T$D$|0D$$T$ЅG<$UVD$<$J0D$t$D$ T$D$D$$mt50D$D$ D$T$$4$$<$T$`t$D$ D$0D$D$T$$U(E ] 3}}utD1D$1D$ D$$D$$W]u}]ÍD$$ED$<$ksu7D$1D$ D$)D$$뙋G<$uTD$<$H@1D$1D$D$ D$0$襃tD$ED$D$ D$D$<$D$<$B]uED$<$D$rED$<$D$9}ɉōvU8}}]uKu1Gp<$1tYE t$T$D$ D$x1D$1D$D$$誂<$R]u}]Íz럐UH``9u  9t 9Qu]]1Ív'U(]î0}lju։T$D$ D$%D$f4D$$t$D$ D$<$kƉ$u]u}]É4$1 5'U8]0EMT$u}׍|/D$f4ED$D$ D$$WE|$$xƉ$4$=t&4$u E]u}]fE4$?4ED$ D$|$$jƉ$t4$14D$ED$ D$$D$苀u0D$E|$D$ D$D$$U4$135U`VSuß. q$L$4$S:t9FHD$ D$'$D$1D$f4D$1҃ [^]Ð&U]E.}} uED$S$fYwD1D$f4D$ D$$D$$J]u}]ËUD$S$Yt<~702D$f4D$ D$*D$$~랋MD$S $XDžlUMD$ $D$GwUMD$\B $D$$w`\`D$$ub\&D$f4D$ D$9L$D$$"~ED$S$JXl<|R\EhuuD$D$ D$Cf4D$$}a`MEdD$D$ D$V륋hMB`AEMdU\D$$D$clh $e0D$D$ D$P+\Eh@U`D$$D$kd $/D$D$ D$\DžpEED$7$HVuUD$$1V `2D$f4D$ D$kT$D$$ |p\MD$T$ $kh$!/`MD$T$ $jd$.Whu4$L$LU`Ut$u؉t$E$-vD$D$ D$uf4D$$0{!`MD$T$ $Njd$P.\MD$T$ $#jh$%.Mt$ $MD$D$ D$zOhMDžpPA;p2D$f4D$ D$cD$$DzCMD$Z $ TED$H$SdhET$L$$Jjth $贁?1~2UdDL$D$h$Ђ9u΋lt*ldhT$L$$hhR``E 9‰|M|RBPxfꀉUE9!F DžtEt%EFT8attE 9V wۋ6;uuh9Mt|dhPU9U|E7E܉D$d$ tE䋕dD$$lu:D$D$ D$f4D$$xEdD$ $tED$d$tE싕dD$$4rD$D$ D$mD$D$ D$N@xEM|$ $ wxBHD$ D$OD$2D$f4|$$wt$D$ D$|$$vEh|$ $ hUd|$ $d tSdEhER` 9‰UME@fxPEU9Ut6MEM׉<$UD$ D$^D$-D$hER` 9‰UMUB@QtO耉E9t?W,hLW(Ƌh<„?;}uM9M>MEM댉$* EƋ@ t1E1FTT8d] EU9V w؋VDtd1҅t}M9N wND Uf4BHD$ D$|$D$03D$$tt$D$ D$|$$t~G,f4@HD$ D$|$D$`3D$$8tt$D$ D$|$$tЋVDtЄM9N Mdhpf4t$D$ D$|$$sD$D$ D$ND$D$ D$o/dhET$L$$P{u h@Tu{`dET$L$$)D$D$ D$f4t$D$ D$i|$$r3D$f4D$ D$D$$or`3f4D$D$ D$|$$:rdJ8$zD$D$ D$|$$qlW,dV,W(d@Mdhdf4t$D$ D$|$$lq/d $6td$,u4D$D$ D$|$$qd$uhATt` $<6th$+u4D$D$ D$|$$ph$Du?uId $#U`D$ D$$D$Zd$d`8$5td$*u4D$D$ D$|$$od $thuH0dP0p4uy4D$44L$T$D$D$ D$|$$xoi`3D$D$ D$L$|$$:o+U(]dÎ}lju֍}4$t$<$D$ 4D$fx]Ћu}]f4D$4D$ D$D$$n1뻍UWVSLEeU1ҋu 5x4PF4Džt&$$8tщ$D$ @|$D$4$oS@:5:u(6:Bu7:Bu8:Bm҉C60D$T$4$t a$?4D$4D$ D$T$D$$al\4D$4D$ D$D$$,l'$ w4$91Ue3L[^_]Ã4D$D$ D$t$$kH|$D$D$ D$t$$zk$34D$dD$$Ϡ$S D$ D$$D$<5D$4D$j$Z4D$4D$ D$D$$jD$ D$$D$5D$4D$oj t&UWVS }1ҋ0  DF u9U u*$D$<$‹ [^_]1Ҁ?-u㍃D$<$趻͍UWVSLE +PMăPPP9N~zF}ċAPt‰D$u4D$ D$D$4$Pt$D$E$FPUu~ủ}ЋPu+U;U}P}̋uċGqP|tЋE|$D$U$d+U;U|L1[^_]ËǃPǃPEԋE$,P1EM DB Mu鋳P~uą}~~Eu8U߈Uu$‹Eԍ&JMp8Mt}u< t4EU9Uu44$L[^_]É<$L[^_]ÉPPq;PM̉u P񉳈Pw&'UWVSU tsPBU싓PEU苓P9U~FErPxkU8T$D$E$ukD8$ [^_]Ã1[^_]ËEǃP$艻PmfL$qU]MA$D$螏M]]aÐU]` Ív'US[]ÍvUSyã[]ÍvU]T~uuu ]1u]ÐF 1ɋP$tҋE D$F $]u]ÍvUSE;` t:` u95D$8D$ D$D$$Ye[]Ív`5D$8D$ D$D$$ e[]Ív'UWVSEo\EMo1҅E18D$8|$D$ D$ED$$dE D$ẺD$ED$E D$Ut$|$T$ FL@$t|$UB$D$D$ D$E$D$d1҃\[^_]D$ FHD$FL@0D$UB$D$8D$ D$D$$c1둍&E̅UEЉBE܉BEB EBEBEԉBE؉BK|$UB$ \[^_]UX}} ]nØuEй$ED$ D$D$tJUЅu#<$]u}]Ðt&<$t։<$ʍv1D$8D$ D$D$$nb$ܽ 냍&USóDL$ M؉ $1D$D$ t E؃D[]ÍD$8D$D$ D$7$aÉ'UWVS1EU1taEp``E9tQE t&6;ut2F$nt}VM6E;uu΋E[^_]EE[^_]Ív'U1҉E]RfUE]? U4$|$}uMEU EM1ɉu }4$|$]vUWVS!L'Ep`ǃ`9E v69tPF$_tED$D$ D$FD$U$@t1}6E9uEL[^_]ÍD$8D$D$ D$C$_1EEL[^_]É'U(E ]+uD$E}1D$$=t5E1ɉD$ D$ED$E$E\NjFL$]u}]UWVS腽ï LeE14$8D$dx 8wj<@F~Ӆ:Fuԅ:B T$$萺D$BLh$jf tAW5D$D$ D$$D$] u1Ue3 L[^_]D$/4$ǬBHD$BL@0D$D$ zD$$t$$莹*j06D$D$ D$#T$$0]l6D$D$ D$,T$$\BL@04$D$gBHD$BL@0D$ D$J$D$9D$D$\DD$$WBLhD$$14$"4$D$BL4$hD$׸et&U(]. }}u.u]u}]Ðt&E D$D$E$91t̋EtFL$릋FHD$FL@0D$ D$>$D$6D$8D$[ U(]u}Nj@LC P0T$$t\|$$.t4$]u}]ÐD$8D$ D$SD$$`Z붍1D$8D$ D$PD$$,Z늍v'UWVSWÁLEtL}uB0D$$4ED$|$4$4$+UED$T$$T<$EUUUBLP0T$$ EU4$D$ ET$D$4$1D$8D$ D$oD$$}GI<$ETGD$8D$ D$D$$+GD$8D$ D$D$$F4$I1fD$8D$ D$}D$$F뻍8UT$D$ D$bED$$sF4$KU1ED$ D$T$D$$?F 8UT$D$ D$_ED$$FfUEU ]U1ɉEU ]o U1ɉuu]FLHt]Ћu]ÍvFL$1t߉4$-yыFL$et$%D$FL$n4tFL$/t$%D$FL$841bUX]$Nuu }$7u1]u}]fEЉD$ED$D$ t$$zEЅtFLP0T$$gEt$<$D$ED$ED$ ED$etv<$af4$x t&>EB6&D$D$ D$ 81D$$CD$8D$ D$*D$$yCUD$D$ D$&뒐&U(]脡î}1uu]u}]ËUBLP0T$$taE4$D$ E D$ED$t 4$fD$8D$ D$D$$BD$8D$ D$D$$nB>'U]E莠øuu }p`eU1҉t$ :D$D$<$胙xS :ddD$`hDžl$_Ue3uK]u}]Í8D$8D$t$D$ D$$|A1ovUWVS觟ED$ D$m$D$8:D$t$%A$腗$tC<$跖ƍ@D$E$9u1<$Y[^_]ÍvEt$D$ D$rD$@8D$$@[^_]ÍD$t$1D$ D$o$T@[^_]ËVE EVEV S&U8]T~uu }~1҅t2EuAEEEE܍}E|$4$D$ E܉D$X‹]Ћu}]Í&EE}D$ EE܉D$|$4$uEt$$uD$8D$ D$D$$A?1tv'USiÓ1҅tD6:D$8D$D$ D$a$>E D$E$=ƒ[]Í&US#)1҅tE D$E$ƒ[]Í&UWVSU 豜B @@$tMT$L$U$ЅM A$裷t|E PrtBt9upU 6Bt9UT$FD$M $uЍD$D$ D$J8D$$=1[^_]ËE P$5M A tp11E  9x v\E PT:uBD$B$tϋUD$T$M $uD$D$ D$[P[^_]ËR$蛶fU B$Ŷ‹@ @@$EMT$L$U$Ѕ*8D$D$ D$Q`8D$D$ D$?8D$${<1[^_]ÐUWVSE 衚9ua&69tTEt$D$U$uD$8D$D$ D$m$;1[^_]Ã[^_]É'UVS20eE1ED$4$!D$ M:D$x&4$Ue3u>0[^]Í8D$8D$D$ D$,$);1hoU]PÍv'UWVS7a,D$ D$0$[:D$t:ED$:PǃPt$艖ǃPPt*D$$SP$UǃPPt*T!D$$P$!ǃPP$葈EE*ǃPED$P$̐EED$P$謌tNjED$P$c}tED$P$?D$ D$*$D$;D$ED$R9XP$+ǃPP4$#t"4$E t E$9W,[^_]Í;D$ED$ D$N$D$8fUWVS1P$"uRP|$$E8#tE8#tD$4$芔P|$$@tPP|$$(uD$D$ D$t:D$$81[^_]Ã[^_]ÍD$D$ D$뷉t$Et:t$D$ #D$D$uƉ$軇u4$/4$觃F]u]Ív'U]ĔuuF$4F$ 4$]u]É'UH]EqÛeU1҉uPt5t1uD$ D$4$APEt$$u1Ue3u ]u]Nc&'U1SPtE$D$蟏[]Ðt&U1҉]u蝓@0u(@t@$t V0҃]Ћu]Ít&'UH]EAkueU1ҋPtGtCuD$ D$4$PEt$$ˎtM ƅt -u1Ue3u ]u] bv'UWVSpE蛒U9ƉEtsEE&N06;ut9E~0$gu9}t N0EEuǃf06;uuNj}uE[^_]v[^_]Í&'US tBT$$Ĉ[]fU8]đɉuΉ}׉EBED$ L$$ED$ t$$hUG<P|$T$$+t}G$@u\UwB$$軒Ut$D$ D$YT$$D$D$D$ D$$D$3,1D$T$$T|  D$TD$4${ $4B4$xD$$|8Pt/pǃ9uč69,t勅HD$@t$$eD$D$ D$jT$$* B$} $ }1$|=D$D$ D$L$D$$*1N8p9,U̍$=<8D$B@$ 8ljahFeF$>D$ D$ $D$:D$ 肄"z$(F$$蟉$|$D$ T$((L$$D$D$T$ L$D$$T$_)<9,<<8MD$@L$$D8BEX8PH@@x $|$ztt&88BDu틅 8AD $пtY D$P$}D$$& (|$ t$L$BD$ D$}L$D$H=D$$O& t$D$BD$ D$L$D$=D$$%P AD$ D$$D$>D$D$%E|$$蹁 t$T$AD$ D$$D$>D$D$J%t&UWVS,u qÛ}4$ftGtG$,~X4$@8G D$ED$U$Mt:u4D$D$ D$zt$$$1,[^_]ËWMt:twUF9tf:҉Eu :UG$v$Ut$D$ D$>T$$D$$?D$t:D$#wEFEt%VH҉UT$E$,[^_]Ívg0&G@$5v븋GvL>t:D$t$D$ D$g$:#G @ƉE U$KuwE$=FHtZGpG$$قUt$D$ D$ST$$D$l?D$t:D$"UD?t:D$D$ T$D$Nt$$y"t&UWVS}E蚀eE1wXWX|9tyEȉxxD$ F$D$]qxD$$t-D$G8D$ GD$G0$D$6;|uuЋUe3Ĭ[^_]ÍG$EOHLtFL<$D$SU EtVPD$FD$@$`U :tD$ |$T$FD$ D$q$D$?D$t:D$ D$t:D$ D$D$$ 1D$D$ D$dt:D$$] z1D$D$ D$k빍D$D$ D$\Mt&'U(]4~^uD$E$t@Pu ]u]ËFD$ D$$D$?D$t:D$FP]u]Í&UWVS}D$$*tst(FV9tH09u[^_]@PtыFLu䍃@D$t:D$D$ D$$FPu둃[^_]É'U]|uD$$wt]u]v]u]ÍUS$U|B0t"ED$D$ D$B$$$[]Í'U]E Q|{uu$1҅tPttT$4$ v‹]Ћu]UWVSU|+B$^{ED$E $rtzpE9u k6;utdF$U4D$B$uU|$D$B$z{uǍ.1D$t:D$ D$D$$[^_]Í;D$t:D$ D$D$$Đ&U8}}]z(uu1]u}]É<$VEtPLtًpE9u 6;ut u붋E UrPMuAH D$ |$V$T$QUD$BL$t $uEE4$;D$D$ D$ct:D$$M썓";AIPuzD$d@D$t:T$D$ D$gD$$eE@Pft&D$D$ D$]EUWVS|EAykeU1҉EE MD$ $EDEE$gUr׃9|t:MF$BT$U$o69tUED$r$ D$juč@D$ED$ D$s$D$71MUuA9uEȋBE̋BEЋB EԋBE؋BE܋BEBEB E>tEEĉENjUD$D$ T$F$*4$.v4$k9}uËM}ȉ|$ $ou1Ue3u(|[^_]Í@D$ |$$tuϋF̍vFt&'U(]EqwÛu}D$P$-stYE1ҍ=ED$P$TtutPPt ]u}]vED$ D$&$D$@D$t:D$}k&U E]vuEE u}E썻;1ҍL;$$]u}]Í&$2uڋUE]u}]W&USu#P$d$mPt|$mPtf$mPtP$nmPt:Pt-$D$3ǃP[]1[]ÍU(]4u^uuPt-E $D$zD$1]u]uʍ@D$t:D$D$ D$[$v1fU1WVSt,PPǃPP} <1U} D$B<$эu*ED$D$ D$$A4$uuӉ4$;vEǃPpǃ9tfF t 4$Ѕt}69u} tuǃP,[^_]ËE :$3D$P$$dčHD$D$ D$t:D$$1됋UB8tB@wB<$>gt&E$2Z;D$D$ D$p@D$D$ D$^t&UWVSr,} D$<$It*ED$D$ D$B$$D$E$D$<$t&ED$D$ D$B$$Nu腬vtZ,1[^_]Ít&EpF$<$4D$tʋF$,[^_]ËEpF$<$4D$qPF$D$E$D$<$AyED$D$ D$B$$OEpF$<$4D$Y*&UWVSE !qKD$E$ZUB$lpPPE9u h6;utaFUD$B$jU|$D$B$puʍ.1D$t:D$ D$D$$5[^_]Í AD$t:D$ D$D$$ĉ'UWVSE !pKD$E$ZUB$loPPE9u h6;utaUFD$B$iU|$D$B$ouʍ.1D$t:D$ D${D$$5[^_]Íq;D$t:D$ D$tD$$ĉ'U(]$oNu}PED$P$jt7ED$ D$$D$,AD$t:D$xED$D$P$gt7EutP]u}]ÍvED$ D$$D$;D$t:D$됍& @D$t:D$ D$ D$$n&'UWVS|EmU MEEUUMe M1ɉEPUEUȉU$D$!D$s^MED$ $E+UB$;EV$gMA$1ɋP$hUB$$`=MA$1ɋP$gMq$F4D$E$j`4$8nUƋEx$$%nMt$ 4|$L$D$ D$PBD$t:D$D$$ UEP$@U9Pt'$#M $hUB?MHuEUN0MBF PL$$g9DF$x47MD$!L$F$4$\Et$D$P$}dYEMD$4$D$ EL$D$0Ue3z|[^_]f4$lU$lMt$D$ D$L$$D$(BD$t:D$ UB$Mƍ@4D$ $hM $$fUB$$Et:D$t$$4Z)ƉNjE UrV4$YVMN$fF$U4T$$WeMPL$$dF$44$12[E$;U|BD$t:D$D$ T$D$5$E4$1ZU$xt&6D$D$ D$t:1D$$Y8`AD$t$1D$ D$$(U$]D$D$ D$닐UWVS fB92uƉ$:d9u [^_]Í&'UWVS 0Ee9uEtT4$c~F4$P(tU9u ;Et9xuU9UtE<$VU9Uu [^_]ÐUWVS 0EOey9uEu/E4$lc~$F 4$P$t<$VU9Uuу [^_]Ít&UWVS pD@DdE9u0$L6;ut!F;GPuGPF$L6;uuߋGPt$|LGP4$IS [^_]Ðt&UVSurdÜF@4$G4$ D$4$FRFFDD$E$.U$tLM9t4KDD$OCT$D$ D$D$$70D$]DD$u4$/uD$4$D$ iDD$mO4$]IsDD$mDD$E$.uD$!4$D$ j1D$OU!E!ƀ1HD$OCD$ D$WD$$<DD$D$E$,UBh$aDD$D$M $,uFlAD$DD$4$-œT$$. sD$D$ D$OCD$$xĬ1[^_]Í`yDt$ D$D$x$M D$xP $'Fpl&lD$D$p$E`D$ D$D$p$Pu`Du`4$|tHD$OCt$D$ D$D$$DMƁ!rDt$D$E$,t$$K:UBxDD$DD$u4$c*F|tD$hI4$D$+ щƉhut|ljuED$D$E$)MQ8 ¸Q8Ĭ[^_]ÍDHD$D$ D$y1l $H?D$|$E1$C2D$<$J9MAxED$U$T$B'E%=`UOCD$ D$"|$D$ID$$+ID$D$ D$#|$$tMED$h$D$lA8tU$DHD$D$ D$HD$OCD$ D$]D$$e$G?$?D$ D$xϣD$OCD$ D$ot$D$$ >$1?D$DD$xD$ D$b$D$ϣD$OCD$l$ID$OCD$ D$rD$$x7HID$D$ D$MOCD$ D$|$D$ID$$=$D>D$ D$|$$D$ED$ID$D$ D$|$$|u4UWVSN$Ru>D$OCD$D$ D$#$>1[^_]Ít&:ED$<$n#puZF$2nv t@tJD$D$ D$3OCD$$1[^_]ÍGED$<$"pu!fF$Piv tftJD$D$ D$DyFD$ D$9D$JD$OCD$$1[^_]ø0$#muBDJD$D$ D$(FD$ D$JD$0KD$낍pJD$OCD$D$ D$,$}7vUWVSLϜeE1G@`DžDžYEDžDžD$D$<$-&FDžplED$<$$!@$pp{ED$<$ D$!$pKD$D$<$%D$4$hh15LD$D$<$"${ED$D$<$#D$<$ƍED$# }\zщD$Et$T$L$ D$D$4$C}ddhD$$跹lED$D$<$!tG@uG@`t G8lW4FUtQv!FD$<$j:U$Ѕt~x$D$E$uNjF;EtH9}uE$-2D$D$ D$E$D$T1"4$>F4$P(륍v'U]d@Îuu}rNjFQu eE1D$$s2zD$$-5OCD$DD$9$AD$/XD$AD$$'/XUA8ǁ ЈA8ȃ$,X$+X$+XD$+$ t$XD$4$-F$-t&D$ j1D$D$4$5,D$$5=D$DD$ D$d$D$Ue3X[^_]É4$-pND$DD$ D$X$D$D OD$D$ D$ZT$$mjj$_.D$$c5G yD$$D5G$WPDD$D$ D$lL$$)$)DD$ D$$T$D$FD$FD$ϣD$iDD$D$ D$iT$$96t&XXǀ/etcF/lvmFbt&D`OD$D$ D$_L$$FD$D$ D$1T$$DND$D$ D$FT$$lDD$D$ D$SL$$<9tDuDD$D$ D$rT$$D$DD$ D$o$D$DOD$D$ D$L$$D\ND$D$ D$:T$$NDžXAOD$DD$ D$$D$Cu:DD$D$ D$uL$$Tf+u5D$DD$ D$x$D$u5DD$D$ D${T$$B?FD$$0G<$qu5D$DD$ D$$D$<$ujDD$D$ D$T$$DOD$D$ D$~L$$c`u5DD$D$ D$L$$# FD$D$<$4GpFD$D$<$w D$ <$`FD$W zjt$ PT$D$\FTD$L $.nLGD$<$L$LWp`<$T$\L$D$T$ uueGD$DD$ D$$D$DD$D$ D$L$$(GD$D$<$P/GHGtLT$t$ L$D$$-%L<$D$6GD$F Wt<$T$D$uxDHGD$D$ D$T$$ TDt$D$ D$PD$D$T$$G(D$$lu$p-"G($c$ dLJGXD$HD$$)GLOH4PDt$D$T$D$ D$ L$$ v'UWVS E13[pDxD9u"69tF$,t [^_]à 1[^_]ÐUE]@Ðt&Ut @BP]É]BÍ'UE тPa`t]Í&'USy2ãD$$Z/t"@@@ @[]fUS)2SD$$ /t@@@ []É'U]1҉u։}Et4EUt2FVMAQV UB E]u}]ÍvF<$D$M+MAƉ'U}} ]u191ctVEƋD$E$*D$G D$E$WF EU҉FuF]u}]ËED$GD$E$_FӍv'U]0þuƸ{t1}4$D$T$d]u]Ðt&U|$4$u ENjEtu 4$1|$]9Nj4$|$]Ð&UWVS,/ Eux>/tutt"Pu(zqt-]u}]ÃuB Bލ3!v'U|$14$Uu MBPRTt:M‰4$|$]2fUUEM U1]'US%uD$@$7"u2bD$h`D$ D$mD$$1҃[]Ð&UWVS7%au,}eE1ED$E D$ D$D$D$4$=vK@bD$D$ D$h`D$$h1҉ЋUe3ut,[^_]Ë! t€tB҃)L$t$G$udbD$D$ D$no U8]u։}eE1#ttp hD$bD$h`D$D$ D$$TUe3X]u}]fBB"\$D$<$uD$D$ D$I&BR<$D$`T$ D$tD$D$ D$h`D$$1BB$WV)čD$'T$$W<$D$zD$ID$D$ D$tf`D$<$D$D$ D$9rfUVS"@r D$pdD$F$u:dbD$h`D$D$ D$$z1 [^]ÐF$V҉tF $D$҃ [^]Ít&t*D$ D$D$$ [^]ÉD$j1D$h`D$D$ D$$ZfUWVS\Eu &qeE1U?U P 1M 9uD.U<$D$ EωED$sD$B"Ur`D$<$2F gBD$<$,lv t5D$<$uҍD$D$ D$J`D$<${UR҉Ut MUe3-\[^_]ËM1D$<$/UB U$1x]E<$D$`D$9D$D$ D$Mv D$D$ D$vD$D$ D$h`D$$@1D$D$ D$D$D$ D$릍D$D$ D$늍D$D$ D$kD$D$ D$LD$D$ D$-D$D$ D$D$D$ D$D$D$ D$UWVSE$#E<[^_]ËD$ D$)$D$bD$E܉D$yEu1$MEhE UD$ D$D$`D$T$$E(u܍D$D$ D$0t$$ۼE `E $ U D$ D$$T$D$D$ϣD$h`D$mEUSj$ED$`$1ҍMEE EEE$E>uJE$kD$h`D$D$ D$$ϻ$1[]Í&E$!$[]Ív'Uuu]}iV ED$T$$ E%=tzF h`D$ D$]|$D$ cD$$F D$ D$f|$D$LcD$$޺]u}]ËF;Et$h`uFt&1É$D$_zD$F h`D$ D$Vt$D$ϣD$$ObD$D$ D$Wt$$%1EF h`D$ D$S|$D$bD$$fUuu]8hFt$'?F$]u]fUWVS @g;GUEG tK8tFE0#uH;Gu' f9GGuߋwuE9GG uG [^_] EUDB tcM;Otʼnu,뽍W9WWt/2t&MDA t uՋWG9WWuщUrEj}t1}t+1҃} ‹MG"<[wtd׋u;wG uK*MDA #={}9wwuGtG;GGu)uDFG9GG<.u΃}G̃GGdGGTGGDGG4GG$EOG9G uVu"WB9GR"th\uٍP9tҀxt̉WNjEG;GGMQ't$9OȉOw'Iu߃GdGG Tt&'UV1H9t^]Éf^]Ðt&U(]uƉ}x+x fÐdGD$F$Ht0EF |$D$E$;E8E]u}]ÍD$h`D$ D$sD$$訵E U8]cuƉ}@|tqFt~+t&&mFD$ D$D$F +D$cD$h`1D$$]u}]ÍF D$D$$ _@uFD$ D$D$F +D$pcD$mF n%GFMFD$ D$딅F D$ D$D$$HGW1}FD$ D$4F nxGto$YGF)FD$ D$D$D$ D$h`1D$$GMD$D$ D$ǍUWVSUa,@EU g t>M#UBhE,[^_]úk1u;UFƉPt*5aUJ u։B UƃPuֺuGD$G +D$ D$eD$pcD$h`D$$߱E=WEEurE p t4u Euσ uuҍ uGD$G +D$ D$D$pcD$h`|$t$D$ D$i$EE,[^_]ÍD$D$ D$\h`D$$輰EE,[^_]ú.EUEPh`|$D$ D$wt$$ME@GD$G +D$ D$tD$pcD$h`t$$릋GD$G +D$ D$D$pcD$볋GD$G +D$ D$VD$pcD$GD$G +D$ D$gD$pcD$kD$h`D$ D$QD$$0D$D$ D$T:GD$G +D$ D$YD$pcD$GEt 5h`b UWVS \UFFF ~ 1E&U~ xBtEt+u߃~ ljxuE8umh`9h`|$D$ D$@t$$حU|$D$ D$t$$諭1[^_]ËE썻h`뻍v'UWVS\UEM [ŰUEȉMĉUD$ MA$z3UM BA GE$ED$T$ EȋỦ$T$/U܋U E؉$ M؋U؉MM)UȋUȉMMM̋M̉T$D$D$ L$D$M$L$=EEEE(7M$Ϧt$L$U(U$T$u$t$U(;E,M $ D$ D$$D$aD$h`D$Euԅ U؉UUUML$+E$$ƋE $ at$T$D$ D$$D$ϣD$h`D$]EEЃ\[^_]Íh`D$UT$E$E$ut$M$L$EUĉD$T$UT$ ŰEȉT$D$U $rDEuE$EЃ\[^_]Ð7EEE1t&EUE$GED$h`D$ D$D$$LERD$D$ D$U$T$EEЃ\[^_]ÍD$h`D$ D$D$$ѩE$ƋE $ at$T$D$ D$$D$ϣD$h`D$gEt&'U(]îW}uD$($tiD$$Vx@@E FFEtED$F$F ]u}]ÍcD$h`D$D$ D$x$聨1뿍cD$h`D$D$ D$}$M<$1냐U(]tÞV}uD$$D$ @$1GFE $E F)t]u}]É<$1D$h`D$ D$D$$|뵍D$h`D$ D$D$$J냍dD$h`D$D$ D$$<$1.D'U(]E 1[UuuD$4$1҅FTt]Ћu]f@dD$h`D$D$ D$$萦]u] UuuE]T}D$F $D$E%=tOF 1D$ D$$D$ aD$h`D$F]u}]ËEUF V!D$$D$ D$D$D$D$D$D$ F4$D$NjFtnEFr71${D$_zD$F D$ D$$D$ϣD$h`D$FF$S*F{&F D$ D$"$D$9aD$h`D$蔤D$ D$D$F $ FtcD$ D$D$$,tED$D$ D$+h`1D$$#D$D$ D$(ǐUWVS };R79u '69t FD$E $u [^_]à 1[^_]UWVSQ }<$ƋE $9t 1[^_]Í79u69tFD$E $Puʃ [^_]Í'UWVS }AkQ79u *69t#FD$E $t [^_]à 1[^_]Í'UWVS E Q09>u 29}t)NjFD$E $u߉4$9}u׃ [^_]U(]EëPuD$$btƉ$]u]Íe1D$eD$ D$D$$ڡ&U(uu](P}} tQt$<$t]Ћu}]ËED$ $tJpD$<$čD$D$ D$&eD$$+1됍D$D$ D$-ʍt&'UWVS7aO}E $79ur69tfFD$E$D$E D$E$u΍D$eD$D$ D$J$n1[^_]Ã[^_]ÐNU]qÍv'UE]@Ðt&UNUҍft@]Í&'UWVS'QN }t:$\Ƌ$\GtF u t$$tʃ [^_]1 [^_]Í'USME$[]Í'US$EíMPx<$ D$ D$4$D$gD$$fD$$[]fU(]$NMuuqt ]u]fFD$ D$$D$7fD$$fD$艞4$t$E $]u]Ð&UVSLqtDD$$ qǃqt$ǃqqt$ǃqqǃ qǃq4$4$[^]Ít&'UWVSL,NfǃqǃqD$($q$tqq$Z qq4$4$XfǃqD$E$F@E88@ Eu덃pfD$$JE$}|$E$E9vE|v FD$E${uڍh$fD$D$ D$|$$E썳$tt$D$ D$(|$$1,[^_]ÍgD$$fD$D$ D$$襛,[^_]ÍD$D$ D$$fD$$h,1[^_]Ëq$ǃqD$D$ D$묍gD$$fD$ D$ D$$ h$fD$D$ D$|$$迚ED$ED$q$qtE$$ft$D$ D$|$$OBTh$fD$D$ D$|$$h$fD$D$ D$|$$UWVS,u ;H}E$G`N 4$|$~44$1F$F(FF FFFFF,$9,[^_]ÍvEuiqD$\$_EqD$ $>}NjED$q$Gu$fD$?ED$$\+EED$C$ D$NjE$G6E@ f1D$$fD$ D$_D$$hD$$fD$ D$QD$$hD$ED$ D$@$D$诗miD$ED$ D$D$D$}E$0iD$$fD$D$ D$U$=ED$q$fD$ED$ D$I$D$E$<$fD$$fD$ D$ZD$$讖l'UWVSʁ,!DeE1 Dž udD$q$ht Ue3,![^_]ËppDž ppt$ q$R3 qD$ $~29u&6;F$T$uًfD$$fD$ D$T$D$$/D$T$q$9iD$$fD$D$ D$9$Ք1D$q$B4$/@q$T$0NjD$q$9c$f9ljS$ffD$D$ D$T$D$hiD$$D$输4$T$Xx D$ D$D$$D$T$ q$Qa=$D$ D$$T$D$fD$ϣD$$fD$$!$fD$ D$T$$D$fD$D$ϣD$藍fU];}}uƉU|$D$$E%=@=`tEft$D$D$ D$$fD$$1ҋ]Ћu}]ËUMCuۍD$$fD$ D$D$$誌1맍|$t$$E%=tsE1҅i[A$t$D$ D$D$_zD$ϣD$$fD$$ 1it$D$D$ D$$ t$D$ D$D$fD$ϣD$fUWVS:LED$D$ ED$Eȉ$QEE+$fEUčvEЋUE̋Ex.EEȉ$U$DED$CEĉD$U܉$qNjED$UȍzD$D$ D$T$E܉4$D$t+1v1ɈFtoD$$QUMB4L$D$ D$D$WoD$$HQUMB@D$ D$L$D$poD$$ QEP@ UB8%,zMΉȍT$ UD$HvL$t$D$T$D$ D$$PM $uunE$ouUT$UhvD$t$D$ T$D$$4PM $9UMBLML$D$ D$pD$D$$OE$;UD$ D$$T$D$pD$OM $D$ D$$D$5pD$ED$nOUMBPL$D$ D$D$NpD$$7OUMBTL$D$ D$D$gpD$$OpD$E+}D$ D$|$1D$$NUMBDb@T$D$$D$ D$$D$pD$ED${NUMR@D$T$$UD$ D$$T$D$oD$KMA D$ D$$D$oD$ED$Kt&oD$ED$ D$$D$sKUoB9t6MD$oD$D$ D$L$$3KzƉ‰Eo0z։Ѝ UzƉ‰E_x UWVS!E} ueU1D$@\G t$$uSD$mD$ D$D$$CJ1Ue3M [^_]Í|D$\D$D$ |$$Dždm9qD$TT$D$ D$$IWLGHD$B0D$D$ D$$D$vD$TD$`IGLT@0T$D$ D$D$PqD$$&IjqD$Tt$D$ D$D$$HoGQTD$qD$D$ T$D$$H<$vD$TD$ D$$D$nHwtWt`DžhDžl0F098vXpfqWLD$ F,@HD$B0D$XD$ D$D$TT$$D$Gv00F0;`dhvqq<$cDžhltwdXDžhlqB(HHGLP0D$vD$TL$ T$t$D$ D$D$$GdiEzD$LwD$TD$ D$$D$FETD$ D$!D$qD$T$$~FllB(Ph@dT$D$\$+TD$ D$%$t$D$qD$FlB(@lD$ D$($D$qD$TD$EWhGdT$\D$$D$ D$,$D$rD$TD$EGlTD$ D$-D$ rD$T$$PEh2l\R8D$$T$TD$ D$3$T$D$:rD$DfP$D$ D$=$D$nrD$TD$DGT$#TD$ D$C$T$D$rD$_DGX:TrD$D$ D$GT$$DdtAE9GXt9TD$rD$D$ D$LT$$Ct&PyrG\x4D$ sD$TD$ D$P$D$CG`TD$ D$QD$%sD$T$$XCdTrtD$D$ D$XT$$Ct&q#t&1|dED$ED$F,$h}DžhdDžlnD$LwD$TD$ D$$D$WBD$rD$TD$ D$I$D$BlED$ED$B,$h}qlqv<$y@ D$ D$8$D$TrD$TD$AGR@TwD$D$ D$:T$$XAsED$ D$V$D$ED$?sD$TD$AEpw\$D$D$ D$0t$$@T(wD$D$ D$T$$@GdWhD$\T$$iTD$ D$%$T$D$qD$U@GlD$ D$($D$qD$TD$@.rD$TD$ D$E$D$?om UWVSU E%e M1Ʌ҉EUED$@ED$$ =UzrXmD$asMsL$D$D$ D$|$&?E$;UD$ D$}$T$D${sD$>MALE$RzsD$Et$T$D$ D$D$$>UrdыBXyTqPEȉUUMP\H`x9ω|x|)x|EUUt$|$$M MUET$UD$$Mt$D$ D$L$$D$wD$=UBd+rht BLsD$ED$ D$$D$}=UB8MIXD$$L$6D$ D$$D$pD$ED$%=UMBdL$D$ D$D$pD$$<.tD$Et$D$ D$D$$<UMBhD$ D$L$D$GtD$$<E}u2D$nD$ED$ D$$D$F<UrtD$D$ D$T$$<Me3 ^Ĝ[^_]ËMQ(/vzt&\srt&+UMUMt&UMBXD$ D$L$D$tD$$w;MfD$sD$ED$ D$$D$?;wD$mD$ D$xD$$ ;t&stzMD$sD$D$ D$L$$:=9^f6hUEU ME]&UEU ME]&UWVS藘EypNjE4$D$Gt}E}u݋} `t8u [^_]ËED$ D$$D$wD$mD$91[^_]Ë[^_]Í&'U8]ėu}1E/MDPugUM MB<2v11]u}]Ív$xiֳ didƍ<Uzt뵍ED$D$ $EUE9t$`MMƃ ЉXE UX 딉| pE 1_SDiiƍ<%i~ƤiƤƍ<@Bi@Bƍ<iƍ<ʚ;iʚ;ƍ<UE]@ @fUM EQPQ$P$]Ít&U(]贕}uD$f$ Ty|$ԇteƋEFF aF FFD$cyD$D$ D$q|$$6]u}]Í1D$D$ D$i|$$6ÐUSE$迈[]Í'US蹔D$ED$E$肔u2yD$TyD$ D$MD$$61҃[] U]4^uu,qt(qǃ,qu]]fD$D$4$tǃ(q뺍{yD$D$4$VuUSE 裓U$D$ET$$a[]ÐU(E ]aËu}uyED$D$8F$qE t$<$D$DEED$@$ D$/Bz]Ћu}]ÍD$yD$ D$6D$$F41뽍yD$ED$ D$9$D$41댍yD$ED$ D$A$D$3<$1Pt&UWVS }+Wօt$PFuW$迅<$跅 [^_]ÍvUWVSE豑} pu Ft|$$u[^_]É<$D$ D$$D$yD$yD$3[^_]ÐU}}]uEwF$豎$F$P4$ք<$΄]u}]Ðt&UWVSǐD$-$z|$}@@@ E $D$1|$$裂gU $T$ڇEFFt$Ս$FtFD$<|$$ J$!Br[^_]ÍD$D$ D$/|$$f1zD$D$ D$8|$$<1$^Ft$4$G$;1[^_]ÍD$D$ D$=|$$0뛍D$D$ D$.|$$01D$D$ D$2|$$|0;&U(E]衎u}xE $%D$G$Rt\t]Ћu}]ËU $D$ D$$D$4zD$zD$/1뮋GU $T$U 29։Et1vED$FD$G$Æ6;u u1҃}Z1҃Mt&U(]E衍upD$ D$8{D$zD$$#/F$$$謨]u]Í'UWVSEHxED$$D$V}EG D$$JEE$D$zD$ D$tD$$L.EU$ZtEČ[^_]{z$S{D$D$ D$lt$D$JzD$$-D$D$ D$mt$$-EEČ[^_]Ít&({t$U$\pzUu6vp{D$D$ D$TU$T$B-v tBuD$FD$G$GD$F$蠥v uG1$XED$ D$D${D$U$T$,E ZPEU D$zD$ D$qD$$X,EFD$ D$ZD${D$E$D$,$袥Et$D$ D$ID$P{D$zED$$+t&UWVS !uމeE1Dž~G$ׅuWD$ D$D$|D$z1D$$/+Ue3e[^_]Ðt&車u"D$ D$D$D|D$랋zD$ D$D$p|D$T$$*t&D$$D$茄,D$$D$x`31 u"03,1 ~$VD$D$$|>1D$D$ D$T$$)xD$zD$ D$D$$w)CYv1$vD$^zD$D$ D$$D$ϣD$D$)$_$ot&u$vD$_zD$D$ D$T$D$ϣD$$(1y;G tD$4$$+}#)čD$/D$D$D$dz$D$ ȂHnD$$ x|D$1D$$T$ JD$D$D$ qz$"G$'v ) D$G$g~  T$G$DzuÅ!D$D$D$ z$~ D$G$v4$D$lzt$ 1D$D$$tAu(zD$D$$T$ ~D$D$D$ z$}T$$Ŧtf1D$D$ D$T$$/& zD$ zD$D$$sD$$ur$sD$D$ D$T$D$$D$zD$%`S&Wr $1rD$ D$$T$D$kzD$ϣD$D$%USE3]@$J~[]Ð&UWVS10~zD$t$ |$D$|$uD$|$D$lDžDD$$zuD$$n|8<$T$uF FFD$ <$m#;2BrЋUe3Č[^_]Ë|H~D$t$ |$D$$tx(D$|$D$k|N~D$t$ |$D$$Htx2D$|$D$DkDž1*}D$~D$ D$)D$$_1D$~D$ D$;D$$(<$u1T~D$~D$ D$1D$$1}o~D$~D$ D$6D$$;It&'UWVSy !$($eE1 nDž0Dž4,f,$oMPpC9u D:Ft~9u~:Fu ~:Ft$zt$D$L$ D$<$7r0|$ D$D$$rDD$$D$h  D$$?j<"Dq\D$@D$$apt$ D$D$X$h@ D$X$`pUDž`p`D$PL$$o`1`} u1`< tD$ D$ D$$`tu1|5BvT\D$D$ D$L$$ DqD9uUe3l[^_]ËD5< tt`P tu|5 u`B< t`{X~ $$$c$DžwtR4$qc;wߋD$4$L$CiuŁtt(\ddpuxr wN $bv x|7>.xyq $b9|w|T$L$$]h^tNt\4LaQ DP at PaQDP t `QDP t `QDP t {TD$ D$D$D$T$$ p $`ih$^TD$D$ D$EL$$C DžlDY$aYXD$ D$$L$D$kzD$ϣD$TD$ W4TD$D$ T$L$D$$ p$_oX$XXTD$ D$T$L$D$ D$ϣD$$1 TD$D$ D$ T$$ p $ _eW$XTD$ D$ $T$D$ D$XD$ϣD$  p$^[W$WXD$ D$+$L$D$ D$ϣD$TD$ (V$EWTD$ D$$T$D$ D$XD$ϣD$ ;TD$D$ D$L$$ 8D$TD$ D$;$D$W DžlX6vUH]E qgÛu}$hM 1҉׉E܋A%DqQ 11 M D$ D$D$ $euHED$ D$D$D$_1D$$x]u}]ËM ED$ $׍}}M܍D$D$ D$L$_1D$$ŘvM AQ $T$5ED$ D$D$D$&E܉t$1|$D$ D$xD$_D$D$$_E $utD$F0D$$P4$X]u]Í&'Uuu]YHt"Pt$L@]u]U(}}]XuD$$JƉtJU @:u]u}]Ít&$dVFtJE<$D$ʍD$D$ D$D$$1떍D$D$ D$ʍt&'U(}}]WuD$$IƉt\U @:u]u}]Ít&$UFt\EBEB E<$D$p븍D$D$ D$-D$$1넍D$D$ D$7ʉ'USE W-D$E$ []ÍUuE u]}D$V@4$D$'NjE D$@4$D$ ]‹u}]!Í'U(uu]}KVu8t+Ht$虇u-@$GuN1]u}]ÍD$D$D$ D$r$뼐D$@$JF D$F0D$ D$|$D$D$$P,@lt~B D$BL$D$ B4$D$} F0D$ D$|$D$LD$$1C831D$D$ D$e|$$^뇍U8]TëuueE1}4$-tEe3,]u}]ËF0D$@D$<$D$ zD$BMxl$f|$F0D$$F ;G th$+<$S<$軨4$C4$=xD$D$ D$D$$&GD$F$t$<$E$rh"&Uuu]R(t0Pt$F@@@ ]u]ÐU‹@B~B]Ít&UE]׍&UE$P U(]uƋ@LRvFt ]u]Í0D$D$ D$fD$$F]u]Í&'UE]tt&U(]QuDt]u]Ðt&d4$^DuǃD]u]!@$g@D$ D$Q$D$+D$D$D$D$4$B돍'US Q3T$@$L[]É'UWV }ufE ut$ D$D$<$Wt߃ ^_]Ð&UWVSP|}E eU1ҋu<$EuLD$D$ D$ D$$1҉ЋUe3|[^_]ÍGTt&$ބ4$D$D$GXftD$ŇD$4$h G\xD$ՇD$4$CG`xD$D$4$$B4$D$D$D$D$ D$XD$D$ D$=D$D$4$%D$T$ $aD$D$ D$A;4$9kB @@tt$$ЅPS`L$4$ 9HWLD$4$L$kB4$D$ D$=AL$ D$a@4$D$T$4$UB @4$D$.D$~L $H8D$D$$!D$4$L$ZT|$D$ D$t$$|$D$ D$^t$$14$D$D$D$D$ D$BD$D$ D$GD$D$ D$WxD$D$ D$UYD$D$ D$Q:D$D$ D$Y|$D$ D$t$$|$D$ D$t$$T|$D$ D$t$$X|$D$ D$t$$#|$D$ D$t$$`}4$T$D$D$ D$b|$D$ D$t$$/h|$D$ D$t$$3|$D$ D$t$$UWVSALeE1<$:D$uLD$D$ D$D$$P1ҋMe3 e[^_]ÉRXX9ʉ`* <$t$D$<$ .D$<$T$ $茊$u)ċt$'$g4$D$u<$D$MD$n<$}QL|4$2uFD$4$D$衤D$<$T$APQT[L$ <$D$T$D$T$W,A\Q`<$D$kT$ D${BdL$ D$a@<$D$T$<$t$@9ЉtVID$D$ $ǮD$D$ D$ `Ct$<$D$D$ D$D$D$ D$D$D$ D$D$D$ D$hD$D$ D$ID$D$ D$*D$D$ D$ D$D$ D$D$D$ D$D$D$ D$D$D$ D$D$D$ D$pD$D$ D$QD$D$ D$2# vUWVS<<$eE1-6UU$E\44$D$ `D$TD$uLD$D$ D$LD$$1҉ЋUe3e[^_]ÍxD$4$.tKD$D$4$tL4$dfu]D$D$ D$OmD$D$ D$MND$D$ D$N/<$o)čD$/|$$p4$D$D$ht+4$u>D$D$ D$WD$D$ D$VhPT$~D$T$=-D$ T$T$D$4$u$D$D$ D$ZA E$O24$D$ ED$D$D$D$ D$[v'UWVS':QleE1D$ˆ$B3"$1B.@XX9ЉЈ1UЉ&D$$B3WD$@$@+D$D$@$|$t$B$1'9NRD$ D$ PD$$1|$D$ D$t$$1|$D$ D$t$$t$1|$D$ D$$t$3Bt$}5Ue3l[^_]Í|$D$ D$t$$D_P$tB0D$D$$TD$D$ D$1D$$|$D$ D$t$$|$D$ D$t$$Pk|$D$ D$t$$6D$t$$tVt$D$$(|$D$ D$ut$$0|$D$ D$st$$^t$1|$D$ D$$8yD$D$ D$BB D$ՈD$$Ou:|$D$ D$wt$$XAP8(u5|$D$ D$zt$$dh<$J'B4t 8B@T$ D$D$D$$u5|$D$ D$t$$hBLD$D$$|$D$ D$t$$iD$t$<$0(|$D$ D$~t$$D$D$$W|$D$ D$t$$\BPD$D$$HB<$$|$D$ D$t$$,&t$D$$d|$D$ D$t$$iB<$FnD$D$$$DD$D$ D$1D$$J|$D$ D$t$$|$D$ D$t$$} uD$D$ D$$YuD$D$ D$``<$[#u{D$$|$D$ D$qt$$ t$1|$D$ D$$&t$$# J$%r`9t?F$mK69u狅p`9tF$GK69u狅`t$$>|$D$ D$t$$H&D$D$ D$D$D$ D$V|$D$ D${t$$LD$D$ D$5D$$W MEqPy@11  lD$t$|$D$ D$MD$$ĊD$D$ D$0D$$Et&'UWVSE p@ QΉE@ T$ D$AQD$ D$D$T$D$}|$$=$#Pu?1D$D$ D$|$$Č[^_]ÍUEQUBREEEUUp xuu}}q(y,u}ĉt$|$ EU$T$EUTƉ׋EU11 uȉ}EEEEt$|$ UM$L$EU9EUr9t&}}|$uF@$!D$ED$UЋMԉT$L$M܉L$ EȋỦD$T$U$0Y |$4$|4U9UUMEUȉM̉t$MA@$ UċE3U3E pu}1D$D$ D$M$L$}$dDD$D$ D$E$D$迾Č[^_]fw M9M*EUEEЉU%1D$D$ D$E$D$[UML$(EЋUԉD$ T$$U܉T$EȋUD$ D$D$؋D$T$U$T$EUEEEȉUEEg1D$D$ D$U$T$蓽D$D$ D$M$L$at$uF1@$Dt&UWVSXEfÐkTN(eU1҉P\t~@G G PXh|$D$ AQ\QD$T$X$UT $A<$D$ƋTD$tyXD$4$>Dž\urMe3 \[^_]ËFD3ALF@3F( L\t&5hыDP u{e뎍0;D$D$ D$D$$fDž\YD$D$ D$D$$g'U8]Euu{åiUU }~EUVF LVMFG2 x[G5A%rG 0N*>FQD$|$$Ϧ 8UET$Ut$D$ D$$Pu2D$D$ D$fD$$y1ҋ]Ћu}]Ð&U8E]u}x òhE$IuKD$D$ D$D$$EE]u}]Ít&ME H0E$u!M@@@ @t$GW$T$E$>YD$D$ D$ D$$$D$D$ D$D$$E뀋Ut$@@$ $D$D$ D$D$$蘸E-F(F@FDUWVS\I ỦEЋ@ fMԉыRX΃XE9Et#EԋB9H u#B9H t9u\[^_]ËMЋUԋE7u̍EN0$UEME,uԃF$ F(OFV F$QV(AF,Q Avx$^EȋE̋H P0E܋Eu zE܉|$(t$$uȉL$T$t$ ED$ D$|$D$LD$$ ut$MԋAQ$T$uЋUMԋ$3<U؋$M؉\[^_]ËUuBHBLF$ F(B@BDBPUԋzr$+|$ t$D$M̋A0D$ D$|$D$D$$Ef1D$UЋ@@$$D$D$ D$|$$蹵1D$D$ D$|$$肵E(@(@,@0@4@8@@@D@H@L@P@X@\@`@d@h=D$D$ D$|$$ݴ&UWV E} EEWXwXE@ 9EtB9H u B9H t9u ^_]ËEM@$@(EE ^_]&UEU ME]&UEU ME]&UWVSEM ;ebE@ QX΃XEE9@ Et!B}@ 9u B@ 9t9uČ[^_]É$Bu=D$D$D$ D$$dČ1[^_]ËMU:EE H0E$ŰE1҉EȋMȸtJMȋAQ Ɖ1y%M1)׋A Q$4$|$D$T$ U}GEW *M}Q1ɋGO(MM̉W$UW EEEUUUE؉U܋Q I$9M܉UMEEEȅMȋQAQ 9UƉ+u}E EE t|U B0D$ D$:D$D$ML$$ѱU$47a}1$1Č[^_]ËEЋUEE؉U܋Eȅt,UԋE t}ȋE9GFw U99M9Mr*}9}fEu}px$U)UMMUM|$ t$T$$L$(D$M A0D$ D$@D$D$}|$$记EЋUEċD$MA$+EĉD$ AQAQ D$T$$E{}Epx$&UЋMԉ|$t$T$ L$$D$D$D$ D$KM$L$}UG$+EĉD$MЉL$ GWD$T$$&ED$D$ D$RE$D$葯9EU11V9E؋U+EUEЉUD$D$ D$cM$L$.mD$D$ D$}|$$ D$D$ D$F}$|$ĮUB$+EĉD$M$ϦD$+}G,D$zD$U $MA} G0D$ D$'D$D$ED$$)SUB$+EĉD$M$ϦD$2+}UЉG,T$MW$+Uĉ$T$+G,&UWVS /\EM$<MUzE$E6EUȋREUUȋMBR EF UV$EUUuUMU9ME1ɉE̋UErzD$0ED$,UȋBL$ D$(D$$D$T$)M̋M̉L$u}t$ |$uD$D$}<$HEUȋ}BR wE؋EȉU܋UuЉ}ԋ0x$H MċI EEM%uzE؋U܉D$,T$0u}ԉt$$|$(UT$ uL$t$}čG0D$ D$t$D$8tjF D$F0D$ D$t$D$pD$$LG$MG$/,[^_]ÐF D$F0D$ D$t$D$ED$$D$GD$ D$t$D$aD$$諧D$G$vYy$D$D$Gt$D$ D$D$zD$$H,1[^_]ËGt$D$ D$D$8D$$ $:D$1D$Gt$D$ D$D$ϣD$$迦,1[^_]Ðt&UHE ]eU1҉uE}TP D$D$E$1҅u#ЋUe3]u}]Ít&:D$/<$tpB04$D$u)|$t$47D$ <$xB04$D$|$D$ D$t$D$aD$$w"5u~|$$6\9$|$D$D$ D$t$D$zD$$<$+1sD$D$ D$t$$ƤiG&UWVSL E SeU1҉E@ xD$/<$Q)=|$D$ D$<$+pƄ5D$<$(D$D$ D$,ur̍D$D$ D$]D$$貣1҉ЋUe3DL [^_]ÍvD$D$ D$W묍t&HnD$$TT$B0D$ D$h|$D$D$$t$BD$$$.lc$D$D$BD$ D$r|$D$ϣD$$X4$l$tD$ D$BD$ D$t|$D$$D$1ulj4$4$9}u [^_]ÍUWVS UqÛKB(tKEP(2U9>u "&lj4$p4$9}uUB($E$ [^_]Ít&U(uu ]K>t]u]fFL4$D$nuًFHD$FL@0D$ D$$D$DD$D$9]1u]Í'UWVSU MKuJED$u}eE10;D$D$ A tL$D$B$C!Itqy FPVT G(W,G ]Gl<$` 9lhpvz WG O W ${hD$ L$$T$ D$D$XL$pT$t$$L$?G WD$T$GWD$T$lD$D$ |$$]`9ʉPA\ A`d d<$a_B\ B`lR9ʉ`w\`x|l 9R A ;uȋzxr| 9}x19אvw\`x|uz`r\:1 9wr9B\R`qyx|A Qx| 9 ~lx|F\V`Fp1ҋxDžT$ |D$+4$|$4 ‰tx|A\Q`w\`$?L$4T$0t$(|$`L$,D$T$ t$L$$D$D$ D$|$$B\R`x|yB\R`x||;qTrKx;yP<x|D$D$$ L$ d T$L$^D$D$ D$D$$1҉ЋUe3W[^_]ËBp1rl|z`xr\>1x|x|p\x`9Q A  9dF\V`u9&-9pF $($;x9u?9w tD$D$$F VtA Q$L$FV$T$kuF $ hht$D$ D$T$$b1O9v $]<D$ D$$D$D$D$ 19:D$D$ D$Gl4$l$vL$F $rueF $D$D$ D$ D$D$ D$Bd$ hG $hD$D$ D$t$D$ D$|$$訒.&'U(]uƉ}@@t@t $)t1]u}]ËF$V|$4D$ BD$BD$F $뿐t&UWVSGq@EeU1D$$,HD$ D$C$D$D$D$*}DžD$D$ D$1D$$|DžD$D$ D$ D$$|DžD$D$ D$#뀋91ɋpxT$0T$(D$,BL$D$$D$ )t$D$|$ T$L$<$D$3$teUD$@T$ $Iu]D$D$ D$ZmD$D$ D$;ND$D$ D$U/w QI px Q$t$(|$, L$U4$X7uvVuD$E$v ǟEZUujd|$D$D$ D$MD$$i[12D$D$ D$=D$$5[1҃[^_]Í<|$D$D$ D$G늍D$D$ D$BD$$Z1뢐t&U(]. u}E$SWU ǍzD$D$$谑<$&WEt$$蓲UU ED$D$$UE]u}] UWVSWÁ,D$($蒱EE 0u?v4NuED$$UEPUU@EG$D$谱UB0ED$$诩UB4v D$4$萈t,@t%@]UD$D$B4$\GǟG D$D$4$^G0D$ D$$D$D$D$X0D$D$ D$D$$nXE$ϱEE,[^_]ËG0D$ D$$D$E썋 UD$t$D$ E$3|$G0D$ D$$D$D$D$TU$賰TpD$D$ D$D$$TE*G`$wGhE$iGp$^CD$4$蠃t@UD$ET$$3tqEDUD$t$$ET$ D|$uxG0D$ D$$D$D$D$SG0D$ D$$D$̘D$D$SE4UD$t$$ET$ D|$G0D$ D$$D$0D$D$S;D$D$ D$D$D$ D$D$$RK<$ѓu?MGda@G\W`;WTr=w;GPv6<$;D$ D$t$$D$D$>E|$$让u`D$D$ D$ FlED$ D$$D$@D$D$>jUMBTЃX$L$苓wMq0<$gD$ t$D$$D$$D$D$>1*UWVSu1[}>tu&NjF $莌4$֖4$|9}uڃ [^_]ÐUWVS EqÛ09>ulj4$葖4$79}u [^_]ÍUE ]uHpVt F$1Ft F$o]u]Ðt&UHEU}} ]M$EEuUU 趗@(M܉U؉ED$<$膔0D$4<$luԅJu}BBFW uG}Eru؉z}܉EBB zB$B(B,B0}ԉr $|$ٍ]u}]ÍѡD$|$$ ED$|$$4-PD$D$ D$|$$&8Mԉ $G1lt&,D$D$ D$ѡD$$711PD$D$ D$Ǎ,D$D$ D$|$$71U8EUM]諕uu}}UMtMD$$yUMpx PHD$E $@]u}]fѡD$ML$$kuxD$ED$ D$$D$61뛍xD$ѡD$D$ D$$z61dvUWVS觔|E ueU1ҋ}EMv0;D$D$ ED$L$t$$&EUMBV$F Q,QA(A҉Et$U$ςEMxMt $(U$詂~,N(v(M t>MAQ t$|$ D$ET$$D$EUz2 u‹Exp tUEMAQMt$D$ET$U|$D$D$ T$A $nEx$p E uMq9utoEȍỦE}ЉUF M|$PT$UL$MD$T$ A $t%Eȉ|$T$D$ẺD$ E$Jt'69uuUb0Me3 uX|[^_]ÍD$D$ D$3ѡD$$/41븍D$D$ D$av'UWVS7alu} eE1LVM2F 001Gt$D$$vV,F(}uW$V$G 4BGBGB G BGBGBGBGED$@(D$<${ѡ,sEuHǃ(9t"fAQ AVQ FV 9uU~FFF r09u =690t3N U;B$uAQ6WA QGW 90ufMGGA( A,G u A0 A4{EEEMT B B yB Bm1zDž@P4Dž8Dž<DDžHDžL}ztdTDžXDž\DžhDžlDž`eMUD H Pxp xU |M B(R,EA$U$<4$@$8$L$DL$x@T$|HL$pTT$tPL$h\T$lXL$d`T$`dL$\lT$XhL$T`T$PL$LMtD$D$,L$8|T$HT$DT$4xL$0MD$t$$R4$juE$e [^_]Í'USv$Le[]ÐLU]ǁÍLU]Ív'LgU]ǁÍUSvC([]f^L'U]Ív'>LU]Ðt&USu$E1҅u$[]Ë tED$E$хt 1҃}ˍD$ץD$ D$D$$US)uS$ t t $[]Ít&DD$D$$nuǃ $[]uc$cD$ D$$D$D$D$ϣD$ץD$7hfU$dtÎt$ǃǃ$u $t$]Ë$t$]v'UWVSt/hd st }Fdd<#tJdht$T$$l~ud>lļ[^_]tdD$ D$i$D$D$ץD$Džl롃}u$t&vp1pD$d$d,pp ǃt<$muxDD$|$$kǃ J&D$ץD$ D$dD$$Džls`$`D$ D$$D$D$D$ϣD$ץD$Ioǃ`$X`D$ D$$D$D$D$ϣD$ץD$2d$:iD$ ץD$ -D$a$cU]EpU u}|eE1$莩t"Ue3U]u}]Ër$uŋ|D$4$D$!D$ D$BiD$t$$@`u;4t$D$D$ D$KץD$$l10L^f$~^t$D$ D$N$D$_zD$ϣD$ץD$1| D$D$ D$ET$N[>t&'UHuEu]eU1҉n }} Džt+r?#tt /|$$*|$D$<$<_$ $?D$D$ץD$D$ D$$Q1Ue3]u}]ftD$ץD$|$D$ D$$릉<$t&1델놐t&vyv;<t&'UWVS} l79uMF@L$耧%D$FD$E$69EtF@L$1%D$FD$E$9uF@HD$ D$$D$9D$ץD$ v9tAt&F@L$貦%D$FD$E$v9uÃ1[^_]Ã[^_]ËF@HD$ D$$D$9D$ץD$" 1[^_]Ð&UWVS} Akk79u69F@L$%D$FD$E$uF@HD$ D$$D$FD$ץD$p v9t=F@L$k%D$FD$E$sv9uÃ1[^_]Ã[^_]Ðt&UWVS } Ajk79t?vF@L$%D$FD$E$69uă [^_]Í&U(uu]i}} XcD$D$<$@‰wةĨD$ץD$ D$D$$ 1ҋ]Ћu}]Í|$$-D$ץD$ D$D$$ 먍D$ץD$D$ D$$ |$$B跚1҅OD$ץD$D$ D$($- |$$ץED$ED$ D$$D$ |$$iDFIt&t&uJD$ץD$D$ D$$n |$$* D$D$<$><$D$4D$>D$D$<$><$D$D$|>x,ץD$D$ D$t$$`D$D$ D$ t$$DҍzuyD$D$ץD$ D$D$$D|$$OD$D$<$=\D$ץD$ D$ED$$&U]euijtij~ijij]u]Ëpǃiju(D$D$$BZ]u]Íxt$D$$_D$4$*`D$t$$^됍t&U(]!eKuijtijij]u]Ívt$D$$YT9pǃijt$xD$$NYt$D$$6^D$4$VTp_4$D$[t$D$$]]u]ÐU]Ít&'U]Ít&'^:'UUTLBKB KB]Í&:UUDMBKB KB]Í&U(E]M ncØuuƒtItTD$D$T$D$ D$>$]1u]Ít&]u]Ðw苄 L$4$ѳD$L$4$۲뾉L$4$蝾D$L$4$跲뚉L$4$ٹ댍&U8EM ]~bèEEu}ME%t*EM]uEEM }E]&t(D$D$D$ D$M$]1u}]ÐU-8E]Í&U 8ֱE]Í&7UU]ÐU7E]#Í&7wU]Ív'7WU勁zt]ÍUS`#ǃt$TǃE[]É'US`Ӱt($rT`([]Ít&USi`ÓED$D$#$MQƃ#[]Ít&US)`St[]ǃ[] US_u6u []Ít&$NVu.ǃ[]ÍĴ$ǃ밍t&'Nt0$iND$D$ rD$t$O뗋tD$D$D$ $GXhUS _3ED$D$5$Rǃ[]ÐU(]^} u} BD$EĴD$ |$$`fD$ D$t$<$Ԉt ǃ]u}]É'UWVS7^a<$E UueE1UED$D$ D$D$D$<$P}ƅtsU|$D$ T$T$$ЋUe3.<$[^_]Ë=7j׏9tL2?YK>ǃD$D$ <$NV#T$D$<$T$ D$ED$D$YU1tCED$D$ D$D$)D$D7$NPƄ Ƅ ĴE |$D$$辕ǃJ Z4$Q! t€uҋ)4$D D$.K$Qf0 |$4$DVv$u =ED$ D$$D$dTvvv#T$UD$T$D$D$ D$$IED$ D$T$$O$ D$@T$N,v蛌rƅEw d膊t#T$D$D$D$ lD$$ID$ D$D$$"N$ D$`S#tD$4D$D$ Ȫ$R請fˉt#T$D$D$D$ lD$$MHD$ T$@C~e}Wt#D$sT$ D$D$$GD$ T$ۊft#T$D$D$D$ lD$$}G#gD$D$D$ qt$P> u?z+ffKt#T$D$D$D$ lD$$F#D$D$D$ mt$ P襉fŇt#T$D$D$D$ lD$$GF#D$D$D$ ot$Ot&ED$D$D$T$ $[O_<$SR%#D$sT$ D$D$$ED$ D$'U(]U U˥uuҍuHnD$4$CGtǃ]u]D$FDt$D$ D$:$D$kzD$ϣD$D$룐U@ tt]]ÍUEHE P9r9]Í&'UE E]@;Ð&U|$} M4$1A;t|$4$]Ðt&A A;G Uuu}}FD$E $t9~ vFVu}]Ëu}] UWVS,E}USEUD$G$PpU BHD$BL@0D$4$D$D$ nD$LpU cBHD$ D$ |$D$hD$$D$4$vmE_E$U UtpED$E UxhpdE9sF D$ D$D$U$dE$U$y,[^_]Ðw9v밍EEf{D$|$D$ D$ $,1[^_]Í&D$cD$D$ D$ $,1[^_]ÍU BHD$ D$ $D$@D$cD$v,1[^_]Ít$D$|$D$ D$ $>,1[^_]Ít&UWVSM싈SQ}U9u If 9tAQ(twD$cD$D$ D$S $1[^_]ËUH9tEf#B ErB9uE耉$Z?UBlщFlBdRhAlFdVhAdAh[^_]Ðt&UWVSUPLL$E؉Mԉ$hEԋw+G);uE t U 92G E܋G U1҉EuEU9UvWuE}UREUuwTEU9W vE 9Usр}uˋMG @ WDE$1D$D$D$ D$E D$D$D$Bl$Eu9D$cD$ D$KD$$fL[^_]ÐEEЃM1+OuVE$ND$D$E D$ED$EЉD$1}D$ E D$E$EvpEt&YuvE9t&T2 UUH}EtEU$D$T$ FD$E؉$U uD$cD$ D$AD$$lEԉD$FH1D$ D$!$D$D$cD$'D$cD$ D$>D$$R'U(]M>uu4$htEFLfP@0D$FHD$ D$ $D$D$cD$u]u]Ít&'U(]Lþuu4$.huEFLNP@@0D$FHD$ D$$D$ܫD$cD$]u]Ít&'UWVSL?,EM$Lg}9FDtUD$T$E$U0F 1E&E U9V v{FT8uUT$@D$E$UtnFTT8E$ME4uD$D$ D$cD$$,1[^_]Ë6;u+,[^_]ÍD$D$ D$묉<$zfƉ$@fEt$D$U$UD$D$ D$WD$D$ D$8&'USESJ}PHT$@L$yt$iH[]fD$cD$D$ D$$1[]Ð&UVS MIU 9u *t&69t9V uFvF [^]1 [^]ËAHD$BD$B@HD$ D$K$D$D$cD$4$nG뢍t&'UWVS,D$U I3B$EEEE1E$7D$UB$:@$l7U ~Bl)Ft$E$?mD$Ft$D$D$D$ D$D$F$U Et_U ~~;zlZE,[^_]ÍCD$D$ D$cD$$EE,[^_]ÍD$cD$D$ D$$xEE,[^_]ÍD$D$ D$w&UWVSLE qGÛD$E$:EU BLp``9ƉuuUԋB;E M耉E9Ɖu6U1EJ ɉMu&E ;M܉ME؉PT:uu 9ru؋@ @ E؋u؋@$vEuRUtE09t#V;UwF;E69uuu荻cU؉t$B@HD$ D$|$D$pD$$t$D$ D$|$$1L[^_]E4u؋EЋ69ƉuU uԋBL6`9Ɖu;UF;Er)EtkEvEEUT$U؋B$nFǍD$cD$D$ D$$18U؋J @uU؉t$$u܋BTDc@Ht$D$ ED$B@HD$ D$|$D$@D$$ct$D$ D$|$$UgUVSDò ED$$v6tG@|@t$3$3$2$2 [^]Í1D$cD$ D$TD$$Ít&'UWVS,EC} 9u !t&69t9~ uF,[^_]ËUBHD$GD$G@HD$ D$0D$D$cED$$D$UBL@$75t#x @D$4$9,[^_]ÍD$D$ D$3E$D$14UWVS,}EUu BD$$GHt$4vD$ BD$B@HD$ D$S$D$ϿD$cED$UErTFE~ GPT$<$Pu/UD$D$ D$[T$$1҃,[^_]Í&'U(}} ]AuuGD$4$yt]Ћu}]ÍED$@$v>tGBT$4$N8붍D$cD$ D$D$$1낍&U(}}]u A5wLu1]u}]É<$9wG0D$GLD$ D$J$D$D$cD$c뢍U(]@îuu}} 4$HuDD$ F$]2t_xwLD$F`$$7]u}]ÍD$cD$ D$D$$늍D$cD$D$ D$$~1뇍v'UWVS,E?ˏp`x`19tMEEE69t2E U܉D$T$F@H$x;uًE9E}ы6E9u΋ED$ EU D$ET$$_8!EE,[^_]UWVSE }>%ueU1҉XG<$\cPoD$4$8t(pt$D$ D$<$t$<$>PD$t$D$ TT$D$|$G$`t$G$7`BHC`EBdBPEBhBT@xB\B`BlBXXtXD$H$D$3`<$T$\@ @t`T$\$ЅUe3`?[^_]ËG0t$D$ D$xD$`D$P$D$Dž`fD$D$ D$oT$$vD$TD$ D$$D$@`T$G$/Dž`D$PD$ D$$D$몍D$TD$ D$$D$@ P$D$D$ D$tT$$Dž`gD$TD$ D$$D$AUhuu U][;Å}}FLUUUE4$VuHFHD$ D$D$D$c1D$$]u}]ËE|$$tGUB0|$1D$ D$D$D$cD$$W뜐t&FQ@t&FHD$ D$D$ D$SE$u1UFHw}EE$Et֋U|$B$4FHE؉D$Eu$04$AU8'cD$D$ D$t$$yE$辠QUET$$DU1$诊D$D$ D$t$$E$L4$TEԉ$TAUẺD$$3*1D$cD$ D$ D$$E$atOu;ujF@L$sU%D$F$D$v;uu'D$D$ D$t$$U8E]A8ku}P8U<$.EE UpHT$|$4$s4u EE8_tG t$|$D$D$ D$cD$$~1]u}]ËU$ .ƋE$.|E|$@$}4EU|$4$D$ sT$D$0t@U zLt$<$}t}G0t$D$ D$yD$D$;;D$D$ D$cD$$1D$D$ D$NjE @Q@uE pH@HD$ D$~$D$ D$cD$,1t&U(}׍I]uT$@L?6iM@$3(t7G WT4$@D$T$A,EwTG ]u}]ÍD$cD$D$ D$k$z1뿍USE5ͅ@t$0[]ÍUWVSEn5Øu},@  MQ@ @tM$L$Ѕ,7U}LJ„D$D$ D$$cHL$$HD$D$ D$:|$$VDžPP[^_]ËEE@ S18D$ $\&T UTB PuLD$$k-PB UPPp PE yAEPFF t"10p4$m"T9z wuE0TF A E DžXtE @lE$XU$9XTyD$cD$ D$D$$ҍ8U8ExFHD$ D$@$D$D$cD$T1C<$%1FL$BWUt$$%D$MuLFHD$ D$KD$D$3FHD$ D$6D$|D$ 4$E7cEUtU4$y7EFHD$ D$Q$D$D$cED$\4$7FHD$ D$V$D$D$ED$4$`u;FHUD$ D$XD$T$D$$ؼ1<$t <$wuhD$ED$ D$^$D$茼1{UD$D$ D$ST$$X1G<$UtU$5tS4$6FHUD$ D$kD$`T$D$$UBL$TU$%D$ED$uU  PD$E$ UE9r EU9ЉEEiUB$D$,L$(E܉D$$UBHD$ UB$D$BD$U BHD$ D$ D$D$E$D$@1L[^_]ËUBD$UBHD$ D$D$3D$E$D$L1[^_]ËUBTDD$UBHD$ D$D$D$믋ET$D$ UBD$UBHD$ D$ D$D$E$D$kL1[^_]ÍND$D$ D$ E$D$4L1[^_]ÍD$D$ D$ U$T$L1[^_]ÍX.D$D$ D$" U$T$ƴ1U $4ID$D$ D$, E$D$7t&UWVS} bGLp``9t8F9t%UT$U|$D$T$ E$ttcGL6`9uȉ<$t [^_]ÍD$D$ D$F cD$$ɳ1[^_]ÍD$D$ D$B UWVSbE}(D$X$ƍD$E$FTU E F EFEFEFEFE ~ FE,F$E0F8E4Fh`.UB$ZD$M AHD$uFHD$ D$ D$HD$cED$$蕱U ꀉU9ЉEUEEB uUȃEME 9J |MȋEAT8uۋ@u@V@ ;B uNjF09u 뼋E6;ptUȋMBTDx B$VEĉF 9UĉEr9wċMEA @ tA E9tE9EvUȸ)EEREЉD$M $[7it$D$ D$y E$D$Vt$D$ D$ u$t$/1Č[^_]ËE)‹UBD$M $6Bt$D$ D$r M$L$ЯuuȋE69Ɖu=M UEEu9EH MEEMEEUE 9P tEuEFT8uЋPMBx A;x uIR U9EtPuԉF 9UЉE9EEp$<$MUԋRNjAU@ $t$(uЉ|$ t$$ỦT$MD$tD$D$ L$D$@ u$t$|}uAut:D$ UB$ M HD$u4$gEEUPTBH@ M܉E؋CD$UBL$d&EUu؋Br$HH@LMx0E܉$UU|$ t$T$$MD$ D$dD$L$D$ u$t$|UB$D$0D$,D$(D$$D$ D$D$MD$L$uFlt$D$ ED$FL@$rED$ UD$4$T$t$E耉$UMB$AlAL@@B$1AdQhD$FL$D$ ut$E$UD$ D$ T$M$L$[uVFT$D$ U BHD$MAHD$ D$ D$D$u$t$Č1[^_]ËEԋ9E}EMu 9M>t&D$U cBHD$MAHD$ D$ D$HD$ut$$oU MMD$ D$ L$u$t$.UD$ D$ T$M$L$MD$ D$ L$u$t$ЪpuD$ D$ t$E$D$衪AX.D$D$ D$ U$T$o1;&UWVS<} ûXE$dt:ܴD$D$ D$cD$$<1[^_]ËUr4D$GL$M"t$$t$D$0D$,D$(D$ D$D$D$D$ |$D$GL@$UB0D$ B,D$4$D$bu>D$D$ D$ cD$$<1[^_]Ít&t$E$-UGlOLB4Gla@GdWhQ@ @t |$$Ѕt,<[^_]Í D$D$ D$D$D$ D$(NfUWVS\@ VUЉM@ G E?G$O8w@E܋GM؋OEGMOE썃MD$G@L$w Wt$0MЉL$,M؉L$(M܉L$$MԉL$ M̉L$ML$ML$ML$MT$D$L$ BL@$ EG 1u hv9w v]t$ |$t$E$1uݍD$cD$ D$D$$=EE\[^_]ËM<$L$H<$E\[^_]ÍhD$D$ D$cD$$٦EE\[^_]Í8D$D$ D$|뼍D$cD$ D$D$${@UWVST,Eu$<EE耉$ithеcD$D$ D$t$$D$D$ D$t$$ޥ1,[^_]Ít&UBT8u}D$GL$U;B tGE1ɉEu4D$D$ D$cD$$`1뀅tA}9w)čD$CE؋ET$U؉t$ D$sD$$GLD$ D$D$D$E؉$E]<$ZcUЅ^GHUD$BHD$ D$ $D$D$EЉEԉD$|E1ɉ$9_D$E܉$UBlUD$0D$,D$(T$U܉D$$D$ D$D$D$D$ |$L$B$?UD$D$ D$T$$$t$UGhBlWLGlB@GdUe3E{e[^_]ÍD$E؉$2GLU؋@0T$D$ D$ D$D$cEЉD$$U܍D$$YD$ GlD$D$E$K3GL$cGL$uXUBL$6U܉$%D$ED$觌GLUЋ@0D$ D$ T$D$E$D$D$!Et&cEED$D$ D$ U$T$՜EOD$ED$ D$ $D$蜜EGLU؋@0T$D$ D$ D$D$E$D$RED$cD$ D$ D$$EGLUЋ@0D$ D$ T$D$8D$$ӛEMGL@0D$ D$ $D$|D$EЉD$萛GL$JED$cD$ D$ D$$ID$D$ D$ =D$ED$ D$ $D$Erw&U(]>Iuu}~l4$XuDD$D$ D$cD$$脚1ҋ]Ћu}]ÍvD$FL$|$D$4$D$ uD$D$ D$낍UWVSLMAkH[E@ UE D0P@U9ЉEMqLUEUEBD$0M$D$(D$$L$,UD$T$ ML$U T$ED$MAlL$D$ ED$@$EUu1 ;}D$ F|$D$U$uэct$D$ D$|$$˘t$D$ D$|$$觘t$D$ D$`|$$胘1L[^_]ËML$E耉$MUEqLBAlf@AdEQh@ uPEU9ЉElMA MALP@ @tL$$ЅnEUIP9ЉE맍v0D$D$ D$XcD$$蠗L1[^_]ÍD$D$ D$Sč`cD$D$ D$|$$DtD$cD$D$ D$j$1U$}+D$D$ D$d UWVS1E)čt$;|$ D$T$4$E؉4$D$ D$D$ED$0?UЋMD$(D$$D$ D$D$T$D$D$ D$L$$tyE؉$WtU؉$RMuND$D$ D$ c1D$$LUe3e[^_]fM؉ $Ֆ׍D$D$ D$ 룍 D$D$ D$ c1D$$Ց뇍ܸD$D$ D$ ʍD$cD$ D$ D$$臑6 'UWVS E} ?eU1ҋG (D$$蜆tiGD$G D$ D$# D$D$cD$$ڐDž Ue3  [^_]Ë$4vB@ ,WTBw#A@!tBvB@9G(+O$vB@!u (GG<1҉҉pWWPDž4Dž8@,4W<pG8@ uHH9uGLw$$9XzGL$D$G$D$ D$ D$D$b4D$D$ D$. cD$$"Dž C(D$D$ $;(ƋG($D$D$;ct$D$ D$> L$$D$\D$袎B@G(SD$ D$N $ȋ)ЉD$D$cD$L$IG<G$)G<8'6D$D$ D$T 4v 't#(D$ $LG8K$裕Dž w wG\tA@ 4cv"G$ GcW,D$GXT$D$4$D$ [00GT;BXt<D$D$ D$ L$$ߌGT0BXG xTG0A\G IPA`D$A\D$ D$ $D$ܼD$D$xG\t,D$0(D$B$}GX0D$(GLD$ D$D$D$$GDž _pD$ t$D$$蕥WD$D$ D$ 4 $`:4@Q@N4BP0D$D$ D$ ND$cD$ D$ D$$VDž wD$D$ D$ 8$ʊ0BL$0L$%D$($uwu m0(D$D$D$ D$$rTumD$}D$D$ D$ L$$:0BL$90L$%D$($;t]D$D$ D$Y $T$ÄDž GD$ D$o D$D$̺D$D$ D$y 7$1?$Dž l0AL$;($%D$0D$=s,-8D$D$ D$ L$$躃{L4D$(D$D$ L$$"L8D$D$ D$~ 0BHD$ D$ L$D$zD$$TGQu 0`P8GD GHt~W@0HHT$D$GP$(4k@L$($%D$4D$qG,40D$BlD$L$$D$ D$D$ D$4 $D$D$D$ D$ T$$'9D$D$ D$ $D$荁Dž 4BHD$ D$ D$\D$$FD$D$ D$: -0BL$0L$%D$($pxD$D$ D$ &$R0BHD$ D$M L$D$D$$eDž 4BL$U4L$%D$($Wo4BHL$D$ D$= D$ȌD$$$4/Dž 0BHD$ D$* t$D$ȽD$$x4 $躾(D$D$ D$, t$$80AHD$ D$* $D$ȽD$D$~$9uD$D$ D$C 4BL$4L$%D$($m4BHD$ D$F L$D$D$$<~Dž ]'UWVSWÁ,M L$M܉F $CE$M L$M܉F $uD$D$ D$EUЋ9ЉEMEI``E9MSUċMyM WHGlL$M܉ $z<E9UĉUȋM FWHL$M܉ $ M FWHL$M܉ $M F$WHL$M܉ $+M F@WHL$M܉ $8_V tDEEEE̋EFTM EEE 9F wЋ6;uUM؋9ʉUU$9M D$ L$$T$~~ D$D$ D$0D$D$ D$D$D$ D$D$D$ D$D$D$ D$zU썃D$D$ D$T$M$L$%R1M @WHL$M܃ $GBMFTWHDM L$M܉ $TiD$D$ D$E$D$Q1M WHL$M܉ $b2D$D$ D$룍D$D$ D$PD$D$ D$1D$D$ D$D$D$ D$D$D$ D$D$D$ D$t&UWVS}WrB9ujW6B9t^F@tt$|$$ЅuٍD$D$D$ D$5 $PW6B9u&D$G0D$$'?u7G0D$ D$; $D$D$D$OD$!G0D$$>[^_]ÍU]购uu }}D$$t$<$>u]Ћu}]Ít&D$4$4tD$t$<$H>D$<$8D$4$3utD$t$<$>sD$<$68D$4$31҅pD&U(]贬u։}EuuYE]u}]G9uG0D$ D$ $D$D$D$MMtv<$uG0D$ D$ $D$TD$D$MM [t&$&5G0D$ D$ $D$0D$D$;ME@<$7G0D$ D$ $D$nD$D$LEUU E?ɅÐt&U(uu]ުtFtt;Bt$]u]ËF0D$ D$; $D$xD$D$7LFfU(]dÎ҉u։}t~|]u}]ÍD$($肣ED$$t ƋEF믍D$D$ D$|$$KE$D$D$ D$|$$XKHD$D$ D$|$$#K럐U8uu ]}}HrF(FLFhEG@F(FPD$F $QuM4$D$ D$m $D$D$D$J1ҋ]Ћu}]D$ D$D$t$<$uĉ4$kUD$ D$t $T$D$-D$D$J1z'UWVS,u 1[FEED$E$F0~XXu9us&?;}teEwD$E$F(u݋G$D$ D$D$D$D$$NI,1[^_]Ã,[^_]ËED$ D$D$D$밍t&U(]DnuΉ}׉L$$ED$WF(D$E$G(F|D$G|D$E$襧uAD$D$ D$D$$qH1ҋ]Ћu}]ÍFtD$GtD$E$WuύD$D$ D$fD$D$ D$zU(]4^uƉ}UD$$ED$4$UBUJ‰tE]u}]ÍvD$D$ D$D$$PG|$4$E먍D$D$ D$ D$$ GElD$D$ D$ D$$Fzv'UWVS,yXXEM9tI9t"GH B;H u,t&B9H t 9uEht D$4$脛?;}u,[^_]ËG$YD$ D$ $D$D$D$F,1[^_]Ít&'USE #MD$E$3[]ÍUSE D$E$2[]ÍUWVS Ep`x`9u.69t(D$HE D$F$u܃ [^_]1 [^_]ÍvUWVS}aËG0$^WrB9EF@tt$|$$ЅtC1 Et|W6B9uҋED$$G0D$$3E[^_]ÐD$D$D$ D$ $`D EuD$<$!EhD$G0D$$[3EpG0D$ D$' D$`D$!G0D$ D$ D$D$D$$CEE[^_]UWVS EѡpXxX9u'69t!E D$F$UtF [^_]à 1[^_]ÍUWVS EqÛEp`x`9tF$蝼6]9uE [^_]Ðt&UWVSE !KEp`ǃ`9u,UJ8[^_]ËF$0u69tԋF$t܋UB0D$ D$r$D$D$D$MB1[^_]ËE`8[^_]ÍU(]EQ{uu $tP Eu]u]ËPT:uED$B@@ $E9sʉ UWVS EџEp`x`9tF$]6]9uE [^_]Ðt&UWVSEeU1rÜEEUHXX9щȉMU&9E;EEt?9};}GUD$B$tӋtUD$@L$B$|MUAr0$|t$D$ D$AT$$D$tD$D$)@?9}EB&MqMF(Q0$T$uMUM9ʉUMAXD$D$ D$=L$$?%4$D$ D$H$D$D$D$h?UME9ʉUpE$CEuE@``9EuJM 9Mt>UB@P@u$菸u܋MA$]ME 9Mu‹E$U$M $pE9tzEx0$YU$EM $誗UM|$$t$T$ L$D$|D$D$ D$uD$$4>EUB`9EEO;EMx8t&FU D$B $ 69u);utiUBxHF@H<$D$ΙuMA0|$D$ D$D$D$D$$p=EdUB`M 9MMt9E-M 9MMu9Eu f69ut_D$F$uF@HD$ D$$D$XD$D$<69uEuUB@ urLBJP7E$Yt0D$D$ D$D$$g)`D$D$ D$ D$$({VLD$D$D$ L$D$ $(l` $`8A D$ D$ T$D$L$D$DD$C(M@M9`X<`M<@XI9ЉMEuU<9ʉU|MQMA ;B uBNtӋ`x $NUƋB$8|$t$D$ D$ L$D$D$$r'UBxhuMaL`LSD$8D$ D$ $D$'` $\Džl<`B0D$ D$ t$D$D$$&D$D$ D$ t$$&`$葽D$ D$ $D$D$D$=&`2nHPD$B$LD$D$ D$ D$$%PD$$IHLT$ $ BHPD$$HLT$ $L D$D$ D$ D$$"%LHD$D$ L$D$F t$$$`B8$% D$YHLPL$D$$tD$D$ D$N t$$o$j4$`$D$D$ D$ D$$$$D$D$ D$q D$$#4$2D$D$ D$ `D$D$ D$ D$$#` $D$8D$ D$ $D$P#K`$8D$D$ D$ T$$ #8PD$D$ D$ T$$"` $PA8 ЈA88xD$D$ D$ T$$|"D$D$ D$ D$$G"BD$D$ D$ D$$" D$D$ D$t D$$!`D$D$ D${ D$$!vUWVSEE09ut&69u~t<$uUEE$T$M EaEtD$ E D$E܃$){uU|$D$D$ D$x U$T$= E܉$U D$D$ D$ T$E$D$1<[^_]ËUE$T$M 1ҋEED$ E D$E܃$^zutMU܋B0D$ D$ D$D$u$t$lE@8E D$U܉$@<[^_]ËU܉$ D$D$ D$i U$T$U܋B0D$ D$X D$D$E$D$@0D$ D$ t$D$D$$E܉$1}E D$ D$ D$D$U$T$E븍vUWVSEq|ÛMU D$$EE$Ep`ǃ`9u mt&69tcD$F$觩uF@HD$ D$+ $D$XD$D$U$EE[^_]ËUB0D$ D$# $D$LD$D$2E$wE맍&'UWVSE 1D$ D$$D$(D$D$pE D$ D$$D$xD$D$4 UEU#EÍvUWVS,u EUD$ E$oNt$ED$B$E}tcEpXǃX9uN69tHUT$F$wtUNBU@ZtRE$,[^_]1獃D$t$D$ D$'D$$df1D$D$ D$,D$$vTD$t$1D$ D$!D$$FUX]m}} u<$KEW@H@9tXG0T$UD$ B0L$D$ D$$D$D$D$$1]u}]ËMQPE@LEUBW;7G0MD$A0D$ D$;D$D$D$$1yt&G0D$ D$$D$D$D$Y17fATGT9BG0D$A0T$D$ D$,D$4D$D$$1U$N<$D9EG0MD$A0D$ALD$ D$4D$xD$돋E$誦<$蠦%9t0G0UD$B0D$ D$BD$D$MEI``E9MW`O`MԉUUM9MB@HEt^u f6;utPF@HD$E$iuG0MD$A0D$ D$QD$ED$D$UM܋9ʉU{Eu@XX9Eu[M 9MtNU|$B$RtދUw0B$}t$D$ D$\D$HD$GXwX9Eug&E9EtTUMT$A$ߥtۋUMBq0$t$D$ D$eD$HD$U(]i}}uu <$蘤G@ tuZwL]u}]Åt<v9D$D$D$ D$0$ 1볾<$o9vw0<$`D$ t$D$8$D$D$D$ 1XG0D$ D$($D$D$D$ 1fUWVSh u }D$/4$B[utEw``9u)69t#FU@HT$$>fu [^_]1 [^_]Ð&USE 3h]D$E$\1҅tP[]Ít&'UWVSlEUgM(} E؋E8U܋U$MԋuEȋEUЋU<@ỦE@@ED$$YEMMD$E$YUB(sE@X@\@`@d@h@l@p@$x @L|$UEt$U.UFBFBF B FBFBFBFBEPD$uF $} }uoMQTAPu19)u4$^D$ D$$D$`D$D$ t&E썳U;PTrM;HP}<$U؋M܉t$D$ T$L$D$8D$D$$EMu؋}܉pPxTQTAP= $肯D$D$ D$$D$4D$D$&E}‰G$@ыR G(D$0|$,E@D$(uȋ}̉t$ |$$E4D$E D$}|$E0D$E,D$ uЋ}ԉ $t$|$RtnEl[^_]Ív4$踮D$ D$$D$D$D$dED$U$XEEl[^_]Ë}<$UD$ D$$D$D$D$뛋u4$D$ D$t$$D$D$T$M $hWEEl[^_]ËM $/<$_eD$ D$$D$D$D$KD$D$ D$D$$E\v'U]4c^uuD$pD$4$TFFF FFFFF F$F(F,FPFTFXF\F`FdFhFl]u]É'UWVSgbÑLEU 8}4$ eE1YGPD$$FB6$(uDht>$ D$ D$D$ D$D$"v$ҙuGl>vBD$t$D$ D$WD$$ D$D$ D$D$$`D$D$ D$PD$$UWVSMH}΋! t€u҃<$)>~)9v@T$D$D$ D$D$$1҃[^_]ËEtT|$E $EuЍD$D$D$ D$$1[^_]Í|$D$D$ D$Yv'U8]Gù}}u跚1҅t]Ћu}]f<$tfE <$D$EOE@E$ӁtvE D$ D$t$D$hD$$G0D$ D$t$D$E $D$D$p18E$ހUPT$$mtgGHoTEE$ƋE$))uEwDGHE$)ƋEwD$yDED$Gp$=E D$ D$t$D$D$$G0D$ D${t$D$E $D$t$$9}t91U }t4E1R1P,$؋RW,$[^_]ËU uك[^_]Ív U9suύ'UWVS,EM >6hP 9ʉUxTI9MwED:ED:Ev.Iw:2D:D2D:D2 9MwߋEI ED1ED1,[^_]ÍD$D$L$D$ D$$/,1[^_]Ðt&UWVS EQ5{EfxPx E [^_]É$mƋ@ Et1EE E9F vƉFT8u@$,t؋FTD$yUDE뽍'UE]u4؄fxPx 1]u]É$lƋ@T8u@$tӋFT@͍v'UWVSU4,$EeE1 /EUuUe3ule[^_]ÐU)č|$#9tBD9uE܉$DlU@)ċE |$#t$ D$sD$T$<$v,UBLD$@D$<$D$E؉D$ U܉D$$P*tUe3e[^_]Í1D$D$ D$D$$`벍1D$D$ D$D$$,{D$D$ D$D$$F}'UWVS2A|EBPUME8mu EEuD$D$ t$UT$M $rt E8EU$M192E&6;uF|$D$UB$L1u؍LD$D$ D$D$$uM MAL$k%D$ED$U$unD$D$ D$_D$$h12D$D$ D$D$$41|[^_]Ã|1[^_]ËMAL$b"UBL$̌ MAL$UBL$j%D$ML$E$M19E 69uF<$D$.uFD$ D$($D$D$D$;멋UBL$;j%D$ML$E$CD$D$ t$UT$M $ot EEXf;jt4}ЉD$MAdQhL$D$T$ E$^iErRiMEEED$MA$+UBHD$BL@0D$ED$<$D$ nD$|'BUBHD$ D$D$TD$ML$$D$<$KH$`8D$D$ D$1M$L$dMAL$fh%D$ED$U$nUMUE1PP9tX6;utIF<$D$F,uFD$ D$OD$D$E$D$밋} tU$ 6UBL$tMAL$RBD$D$ D$YE$D$M` D$D$ D$ ED$$EpD$D$ D$ UT$$4$SUBL$f%D$ML$E$ӼD$D$ D$7"D$D$ D$SM$L$?1UBL$=D$D$ D$,UT$$U$Eu)@D$D$ D$E`MAL$e%D$ED$U$輻uD$D$ D$>ED$D$ D$D$4$aY|$D$D$ D$U$T$4$AQ[x|$D$D$ D$E$D$%MAHD$ D$D$(D$ED$$yUBHD$ D$D$D$ML$$7fUWVSe)Ïy)čD$3EԍT$Uԉt$ D$$T ?E܉1usU؍D$BL$AD$ D$D$D$D$D$|$D$ E$U.;}t}U؋BLD$ D$D$D$Eԉ$U[D$D$ D$D$$1Ue3uke[^_]ø@HD$ D$$D$D$D$1먍D$D$ D$q'UVS0ED$ED$D$ D$t$FLn%Øu$,t1}0[^]ËFHD$FL@0D$ D$$D$hD$D$01[^]Í&'U}} ]$uuuOP~D<$t$<$]u}]Ðt&UXE]eU1$ït}uu }}EvO#D$D$ D$D$$1Ue3]u}]ËEԉt$$EUԍD$$>E܉|$ D$(E D$$FlT$D$D$ED$E$D$ED$ED$ FL$EM$Et5UU T$U$D$ E$U؉D$EE\$$@D$ ED$t$$N$t+U)ċE؍|$;<$gEtxU$t9UBL$ˉt'UBL$9tUBL$5t&D$D$ D$D$$ E؉$1D$D$ D$D$$14$Z@T8D$D$ D$뮋EUD$FPT$|$4$%@ D$ t@U$unE؉$aD$D$ D$*D$D$ D$D$$4$YUT$$7sD$D$ D$D$$>D$D$ D$D$$zUt&Uxuu] p}} vA D$D$ D$u1D$$]u}]Í$(t,D$D$ D$z몋GL$ZfU|$$ED$E$:E[t-UB@ t UD$D$$ЅEUD$t$D$(ET$$UD$D$ D$ ET$D$D$GL$EED$ED$ ED$D$|$${1҅t 1҃}‹ET$ U4$D$ET$Ulw<$:Wt$$U$HEȉD$ED$D$ |$$;_t EȅeGHD$ D$D$XD$1D$$D$D$ D$1D$$輿D$D$ D$Ǎf1D$D$ D$D$$hD$D$ D$UBD$ D$D$D$D$D$ D$D$$uUWVS,EU8m@``U9ЉEEUB9ut&U?B9tlEw D$U$69u֋GDtω|$$uD$D$D$ D$$,1[^_]ËEU9ЉEY,[^_]Ðt&UWVS,u D$U@lB$E}}<$ F``u9EU}R9UtdꀉU9tTN tkFT1  9tZ8u}9xuD$ UB$wt<}܉xD$E$NU}9UyE,[^_]Ë6;uuٍX.D$D$ D$fD$$˼EE,[^_]ÍKD$D$ D$S뼍'USEjD$E$茩tED$B D$E $[]ÍD$D$D$ D$D$1ƍvUSECmj9tB @ tBT8t9u1[]Ë@@@ $[]Ðt&UWVS E j耉E9‰Ut;Ex t"pT>t-V 1 փ t9uEU9ЉEu1 F$, [^_]Ít&UWVSvGHD$ D$gD$D$E$D$UB@HD$ D$ZD$D$M$L$譭UB@L$ ]1tEW}tUE=}0MtU)UċEċMUBHD$MD$D$ D$L$E$D${UB@HD$ D$|D$D$M$L$Ĭ1:GHD$ D$wD$$D$ÍD$D$ D$:U$T$m1D$D$ D$ʍD$D$ D$E$U$BpDM $BPDEpLD$$oHD$D$ D$E$D$蝫D$D$ D$D$D$ D$ UWVS1D$D$ D$D$$1FHD$ D$$D$D$D$Ģ1ED$ED$ ED$D$t$$] D$D$ D$]$0&U1(]ìPM uu} wvE]u}]Ãuw9sED$8D$D$ D$D$$譡뫍t&'UWVS<} O|$E$蚶D$E$E6ED$GlD$GL@@$Et$(ED$$ED$ GlD$D$D$ED$ D$ED$D$GL$ED$|$4$D$ Et4$7E<[^_]ËGHD$ D$$D$D$D$eE뭍D$D$ D$D$$,EE<[^_]ÍD$D$ D$뼋GHD$ D$$D$hD$D$ǟEE<[^_]Ðt&U8}E}]Nuu( u?5tC:}D$D$ D$:y$-uEtzE$|$D$E D$ED$ED$ ED$E D$E$2D$D$ D$$D$$诞1]u}]ËE$|$D$E D$ED$ E D$E$ƋE$D$E D$ED$ ED$E D$E$떍v$,t&@D$D$ D$5GD$D$ D$I('U(}}]8LuG$h!t`@ @ t]u}]ËG@HD$F1@HD$ D$p$D$DD$D$T멋G@HD$ D$j$D$ D$D$jvUWVSGqKEvE$e<$3$t@]V 1ɋFD$D$$.uD$D$ D$E$D$]1[^_]Ã[^_]ËGHD$ D$D$hD$E$D$1[^_]ËF@HD$ D$D$D$E$D$ћ[^_]ÐUWVEUE9ЉEE@8E9tfUBPttEUE9EtEM ;Mt9AuwQ 9sG Q9vЉ‹ )9!U;Muf?9}uUE9‰UxE^_]ÍUWVS|EU.XI@XXU9ЉE!@EEEEMẼE@PtEȃtE9‰UZEEEMEEЍiUЉME@EԋBtP@U@HEMЋEȋqy $BBUԋMt$ |$T$,UL$(M؉D$ED$ T$$UL$D$D$T$$ЙMЋA ;Et?D$E܋UD$ D$D$nD$T$$荙EMЋQMԍI4BT<0t:D$ED$ D$$D$5MEQBTM9Lt:D$ED$ D$$D$MEQMЋR$A9t;Et,t&9uUԋE tt&^_]ÍU-D$$- U"VuU ED$$\uDE^]ÍUUVքu>t/<\JuBJ<"t<\uٍBʉuҐ^]Ív'UWVS }!K7<-C9tq~9u~:Gtq&WEMAu<.t<_t <-t<+fu.t:u1 [^_]D:Gu 1[^_]~:Gu萍&UWVSGqzFD$Et$$]u}]ÍED$EED$D$ D$|$GL$^t}tE<$D$UnE D$$]kE\$ D$D$<$pك M$;nEVt$|$$/&D$D$ D$.D$$F1D$D$ D$=ǍD$D$ D$B뫍v'UX]tÞ}}uu/D$zD$E$i]u}]ËE D$$<$VED$D$ D$|$GL$t EȅED$ED$<$!}E D$$蘕E\$ D$D$<$蝜ك M$hlEVt$|$$\Ft$D$D$ D$D$$D1dFt$kD$D$ D$뫍D$D$ D$ UVShÒ0u4$袽tE4$ֽVL@b@EUED$ED$ ED$E D$E$00[^]É4$1uEE붋FdVhEU USɡ$E耉$蜜EED$ED$ ED$E D$E$6$[]UXUEЉ]uu}}D$D$ D$T$BLGq$tEЅu*D$t$<$`]u}]Í&Et$<$D$ED$ E D$_ɍ'UXUEЉ]uu}}D$D$ D$T$BL藠$EtEЅu*D$t$<$谕]u}]Í&ED$t$<$׍t&'UXUEЉ]uu}}D$D$ D$T$BL!$tEЅu*D$t$<$]u}]Í&E܉D$t$<$y׍t&'USE胟íD$ED$E$葖[] UWVSGq\E D$$5[UBH8BP pUBP G-MAT3GƋE@Q@UBP<mGED$D$ D$T$BL$RtTEtMuąGsU؅}ྃoGED$|$$s\[^_]G-G-uC%ໃrG%v@uvcGwt&袑ыGD$D$D$ D$.$T?1KM؅u}iGGaM $许ED$ED$E$t }}SGM $1toUBPfy% MulM $$膠‹E@RtPtLED$ED$D$ D$BUD$BL$2th}u=it&JD$D$ D$D$$=IM $X຃sD$D$ D$D$$=멍t&U8]贛uu}4$Kt,FHEED$ED$E$4]u}]ËFH$ܑxE |$$Z‰EtWFH|$$D$ D$dxmFHD$E $tsD$ED$E$$vD$D$ D$D$$~<1?D$D$ D$ǍD$D$ D$ U(E]aËuuEE }}EEE4$膵t24$ʵ]}u}EEEEE EE]AzD$D$E$]u}]ÐUVSș D$(E $視twD$(D$E$} u9D$D$D$ D$A$; 1[^]Ét$D$E$e [^]ÍD$D$D$ D$<$: 1[^]ÐUUHoz  tB @]Ít&'U(]贘}uD$$ |$ԊteƋEFF F=FFD$cyD$D$ D$|$$9]u}]Í1D$D$ D$|$$9ÐUSE$迋[]Í'U]贗uutǃu]]f D$D$4$u 1҉뼍D$D$4$uэvU(uu]U }M$?}F tNFT$L$<$D$ 迈F D$ |$t$D$E$i]u}]ÉT$L$<$(uD$D$ D$ D$$(81뫍t&F@HD$ D$$D$P D$ D$71fD$D$ D$녍vU(EU ]u}x ;z t1]u}]É@;BuAT8EuԋRT:UuɋI$MPEHB;AuE1B ;A Et@뜍t&U| uM| uTLB;ApE B ;A ^E9}uE LD$EL$E5U 11MBAB$Q A$u6E 9x v(MQT:uM ATD0D$B$ʸ&'U(]E 葔ûuuD$4$ D$hu>4$aD$ D$@$D$ D$ D$51ҋ]Ћu]Ív'U(uu]}} "~ tFD$ D$<$1htSyD$<$dF$1v F$ED$L$|$D$ 4$]u}]ËFpH<$`D$ t$D$OD$ D$ D$$41멋FpH<$r`D$ t$D$UD$ D$봍&'U(uu]ޒ}} F zD$ T$ D$<$AtP~ v%V D$ D$<$T$T$%G D$t$<$A]u}]fD$ D$D$ D$b$31뽍 SUWVS,}+G f D$ D$D$ D$*UT$$v3G@L@8WD$$T$-D$ D$/$D$ D$ED$3O t^B 1otEU쐋EUt$D$ D$T$D$5$2Et$<$D$|9w wU荃rtD$D$ D$9T$$2,[^_]ËGUD$ D$2D$- D$T$$L2+qtD$D$<$ EhUWU V}Sux-EE9EuG,[^_]ÍL D$ D$D$ D$$&1,1[^_]ÍU 4$u|$} 4$|$]Ít&UWVSA}ĵtc f!tED:<u퍃t D$ D$D$ D$$m01[^_]Ã[^_]D$D$4$*0$ vBu`'U1ɉVSFp uU v<-t Nu tU D$D$ D$ D$$/ 1[^]Í D$D$ D$ʼn4$ [^]Í&'U1WVSu艍óD$ 4$ 1҅tC$ ET1C!Uk>)U}U:D1!uк[^_]Ív'UWV1S/ } t&t|> 0t 1[^_]^D> DBt u [^_] U1W1VS蓌ý $ UUD D$E$}t+E4! uŃ [^_]ÍUSM U JABABA B ABABABAB $?[]É'UU WMVuS輋B$ FBFB F BFBFBFB Fȃ?҈D2 uFG[^_]ÐUE]@ @fUM EQPQ$P$]Ít&U(]>}uD$c$ e |$4}teƋEFF aF=FRFD$cyD$D$ D$n|$$N,]u}]Í1D$D$ D$f|$$,ÐUSIsE$~[]Í'USCRD$ED$E$u2t D$e D$ D$JD$$y+1҃[] US虉ȶu#RD$ED$$ĶĶǃȶ[]Ít&'USE 3]U$D$ET$$衆[]ÐU]Ít&'USE ވ@ u2D$ D$ D$D$$`*1҃[]ÍUWVS臈ñD$ ED$$,zƋEã~FF$>F >;FF 0F(4$GFD$<$t>FD$ D$D$nD$E$D$)[^_]Í D$D$ D$E1$D$K)[^_]Í1D$D$ D$E$D$)댍 D$D$ D$ 딍t&US)SE$z[]Í'U(}}]uD$G @$ɃtZƉ8E4$suD$G@$蝃ted>BB T$4$k}E]u}]ÍD$D$ D$ D$$'E뷋ED$G@$yD$D$ D$밐t&UWVS!tut$Ẻ${U؋9U܉UU؋zD$Eԉ$萁 |$D$ D$t$$&?t$Uԍ $w|$D$ D$t$$%|$D$ D$t$$%1D$E $0Uԉ$<[^_]Í1D$ D$D$ D$$Y%<[^_]ËE D$Ủ$Ẻ$UT$ U B0D$ẺD$U$u5D$ D$ D$D$$$!E̾D$U$ UWVSD$( $|\E쉅D$hq\ U@D$E $5}D\T$|$ QR~lwx~hw [^]ÍD$D$E@$D$ D$[D$LD$ D$$ 1[^]ÍvD$D$D$ D$V뺉4$脛D$FL4$D$8'UWVS<} D$D$qvÛG(D$ G |$D$UB$yGPWT A(EQ,A A$dUU܉$d GdGXG\G`D$$7oE`D$E$rcUPG F F|$D$ D$T$UB$uED$ D$ D$D$$E$op<1[^_]FFF4t$E܉$lU܉T$E$tU$ p<[^_]Í&D$ D$ D$D$$p]D$D$ D$m D$$;<1[^_]ÐD$D$ D${Ít&D$ D$ D$~D$$t&'U(M4]uu }}QTsAPvAPQTEu]u}]Ít&EUM4t$ |$D$T$ $o. M4Q`A\11 D$ D$D$ D$F$1pED$D$@$D$ D$5$D$xD$ D$1&Et&>uE9Ad<D$ D$D$ D$A$/1&UWVSWrÁ,}D$ $kƋE D$ D$D$D$ ED$$G@D$U4$T$XMEMUGTG`GlGXWPWTG\GhGdGP?GPD$U$uL<$蔥D$ D$g$D$D$D$@1҃,[^_]Ít&<$HWTƋGPT$D$MA$t$D$ D$lt$$D$D$EtPMGda@G\W`;WTr<<$ɤD$ D$st$$D$D${G|$lIGt$aI|$E $&g D$D$D$ D${$,1[^_]ÃOLt&EOL܋ED$M $SG(=LD$D$ D$CD$$1R<$訣t$D$UtD$D$ D$QT$D$$I-t&4$D$T$xJEp4;GPbvUWVS,UE>Yh29EU~D$U $U‰GtD$FD$T$ED$ F D$U T$E$nGUP$|$E$OU6;utQD$E $JeED$ D$D$U$T$ ,1[^_]Ã,[^_]ËUD$ D$T$E$D$,1[^_] UWVSWD$D$E$mIUHBMMfBUM,A,MABABA B ABABABABQ(t $褐EUB48M $tiMQ4:9uNE,KuƬ4$nM=Y4$XMPV_Ef@XP@E$菑uEP4:U,Et4MEy4,?D$t$<$RUBLu^UMBPǁEtUB@MUAdAhA\[^_]ËMǁ֍ND$t$<$FUBLWD$D$u,4$FID$t$D$D$ D$$1[^_]ËEp(D$D$ D$D$$1[^_]ËEց,z&BD$D$ D$fMUAX֍NuUE,D$D$ D$8D$D$ D$D$t$E$!EUWVST1D$($?M|U$ KE p``9uv6;F@QuD$|$oP(FF@lD$| $UEG 2|$F@HD$<$LzD$D$ D$Gt$$$Pht$1D$D$ D$]$pUt9UFB D$M $sD$D$t$C°9u4%8tB<B6;~D$/<$DD$ $MuB $HS|$D$ D$^t$$D$D$6D$D$ D$zt$$ PD$D$ D$bt$$1<$N|$0Lļ[^_]ËDžt{&ftNxN;Hlb<B 8B T9w9E$s@tUt$ $D8Olt"@ 51 <'9ut$$Hu$ @p|$$HDx1ҋqlqlpL$E$iH1҉DžxDž@ Ћx|8Dl;x1l=;llj;lut@9AtD$0D$,D$(D$$D$T$ AD$D$D$T$ D$|$UB$;AH Bx19y P BD$ |$D$$)u|$D$ D$4t$$|$D$ D$Lt$$rDD$D$ D$jt$$Hav1D$D$D$ D$Z$ļ[^_]ÍD$D$ D$?t$$"D$D$ D$Dt$$0D$D$ D$6t$$gvB $-Mt$ |$D$ D$t$D$L$D$$D$D$ D$t$$,L$D$D$ D$t$$GHD$ D$D$tD$t$$W|$D$ D$t$$3E @8|$D$ D$gt$$l|$耉$@9xAH|$t$D$ D$D$D$D$$jz #pT$M $cDž?Wl1B 0‹H9rut B 9tD$0D$,D$(|$$D$ D$D$D$|$L$ |$D$UB$6Q BD$ D$4$D$H%t$耉$E?F9JlL$<$@_|$D$ D$t$$|$D$ D$t$$d D$D$ D$t$$)|$D$ D$t$$YD$D$ D$)뎐Uщ]!щÍ&'U‹B]΍&'UV@@@FF F FFFF HFFF$F(^]ÍU8]}}NFxuwiN$F( 9)ȉF(tw+]u}]Í&D$D$T$D$D$ D$Q}D$$Z1뢍dD$}D$D$ D$i$ 1eD$D$T$D$D$ D$Xtt&UWVSEA;1҉D$ G,D$0t$T$L$$@,F, F(F$/f0Ue3[^_]Í&4|$(T$4$t (CD$D$ D$GD$$`1gD$D$ D$O&U(]d@ÎuD$y$t$2t‹EB]Ћu]ÍD$D$ D$zt$$1ƐUWVS?D$(}썃$ 9P<$^.P|$PD$ E D$D$E$`LD$D$$0u9u Et&69t:tU$T$1D$5ED$$,'0ƋEU;~FF>F L;FF F(4$#FD$<$|t>FD$ D$OD$nD$E$D$[^_]ÍD$D$ D$KE1$D$[^_]ÍTD$D$ D$9ōD$D$ D$F멉'US<E$0[]Í'U(}}]uD$Gp<Ú@$i.tZƉ8E4$+D$G@$=.te?BB T$4$2E]u}]ÍD$D$ D$D$$E뷍D$D$D$ D$$VED$G@$.Eft&UWVSg;Ñl}D$($4EEE$)Em@D$E $UMT$ L$D$$J@@D$Eĉ$,E ŰM@։JXzB0B8BDBTB B4U4$3)E`Eȉ$")Eh$)Ep$)UMċET$L$$Q u}t$D$ D$UT$$Et$D$ D$D$$U$4EEl[^_]ÍEċMUt$D$ L$T$$=EUċMD$T$ $<r};}]EEt& Mk4;ut$V8F$F ,FFk(FN4A A0QA?;}A?uEԋUakMD$ $* E?t$D$ D$ML$$ Mk$D$E$=*F)$D$ D$?MD$D$L$$Ut$D$ D$T$$|XD$D$ D$oED$$>}ԍUtM̋EI0M7^GEEEԋp t)@1B9uEE9EU܉UԋMԃU܋ uEЍMD$ D$UD$)L$D$UT$$evD$D$ D$D$$01ɋE؋UЉL$D$ D$T$D$D$[ML$$Ut$D$ D$T$$t$D$ D$ED$$D$D$ D$D$$JEED$ D$+UD$D$T$$VMEċUȉ|$L$ D$$rYt$D$ D$EEUWVS4}D$G$.ƋE D$ D$D$D$ED$$7G@t"ut&B 9tr>u D$Et$D$L$D$ D$$ [^]Í'UWVS\EU2Ȃ9ЉEEuԋvFQuMEEEuVBUBpxD$U؋BL$HLEP D$0D$,D$(T$ ։t$$D$@D$T$D$U܉T$ u؉L$t$E $EU11R uU9r D$ UBD8t$D$E$!uōEt$D$ D$|$$t$D$ D$|$$1\[^_]ËuFD$ELD$E $0UT$E؃耉$'uvu܃EEE9EBUԋu9U눍D$U؋BL$JE:u1EF 딐UBD$FLD$E $0D$ UBD8D$4$D$ t$E؃耉$&UEFuE9r UBL8T8D$0D$,D$(T$$D$ D$uFD$T$D$E܉D$ U؉T$ut$E $lED$D$ D$|$$t$|$D$ D$$\1[^_]ÍEt$D$ D$|$$n렍XD$D$ D$E|$$6TEt$D$ D$|$$4D$D$ D$뎍Et$D$ D$|$$t&'UWVSE-}}09t.40GTGDGDGHG0t6;uu҃[^_]ÍFD$E $_'G0D$D$ FVD$GT$$O8G@GLGPG<fUWVSu-;}}FED$D$<$U D$D$ BR <$D$T$ EG$,G t$u 4$&G(Et)D$D:D$L?$\~Nj;x vr71DžztADž4$tF$t>ui D$$T$ljDž8uMSt$$4$ 4$|D8<$T$j$<D‰փ4$D$T$$F~1$=;u狕$% Dž D$D$D$ D$~$诽 Džk7Dž L 0@4$ D$ D$$T$D$D$ f Dž UWVSAkLU EEUЉEeE1 E؋EԉU$RUԍx!)čt$/FT$$NEzFD$ED$4<$hE܋EU11 9E胸ptዀ8tU;U T$D$ D$D$E$D$4D$D$螻U9yvEHEU؉E܋Ue3u!e[^_]ËE苄0zUЉ_t&'UWVSLEoÙiUeU1҅MЉEE;M̉ $P!)ċE̍L$+UD$ȃMȉ$EЋMȉƒ?ΈA>KQKG8u̹󦍳z8GQUMȉT$UT$UEE׉$`U҉E11Mvvtb8D$MĉED$ D$lD$;D$L$$ӹEUEU 9~]E싈pyD$D$ED$ D$d$D$h듍 $FvM؋E1E؋Ue30Ee[^_]À}3tEЃte}ЀC\G8OIf1ݍD$ D$D$:$ )'UWVSlEfu eU1ҋ}4$ =:u|3>#tt&t$ 3D$D$$l7Dž3wft&tqD$D$D$ D$D$$臷1Ue3l[^_]ÍaT$D$D$ D$뭍D$t$$ fDž223t$ xD$D$t$D$ D$$ɶ+4$q'[|u zxz@uz uzu zT$(L$,|$8D$4T$$t$0D$ D$ T$D$$D$D$T$D$誵$MX^D$ D$TD$$5D$ D$ -D$$ jUE]@ @fU(]cu}׉EM tc|$$uE4$D$t 4$1]u}]Í&E4$D$E4$D$ʍD$ D$ D$D$$똍&'US)SbE$[]Í'US#bD$ED$E$u2D$ D$ D$ D$$Y1҃[] U]tÞauuжt̶ǃжu]]fD$D$4$ru 1҉̶뼍 D$D$4$ruэvU8]E aD$ ED$u}0D$E$ t>u:18u E ]ȋu}]Í&M u}1yM$EUQ uM 븋UE11 tM 뚋E U8]E+`uu D$}4$BD$:uFD$D$ D$+ D$$f1]u}]Í&$D$4$ǍMD$XE)4$D$D$3<$衭EUD$B@L$٦Ut$B@L$躦E|$T$D$ E$+(<$4D$D$ D$3<$ @D$D$ D$9`D$D$ D$AD$D$ D$GU(uu].X^}} F8<$D$WD$'uCD$D$ D$R D$$蓯1ҋ]Ћu}]fF(@H<$D$gD$ļtDF,@H<$D$uD$褼uD$D$ D$TsD$D$ D$ST'U(]$ N]u}D$@U$ tXD$D$<$1҅t"D$D$ t$<$PhE0]Ћu}]Í&D$ D$ D$D$$01붍U8]T ~\}uD$0$ |$tƋEFUF Fd?FFEu@FD$ D$B|$D$cyD$$x]u}]ÁN 뷍1D$D$ D$6|$$4fUH]U}lju@V À[M܋pLu?D$D$ D$ D$$ͬ1]u}]D$ G,@HD$F0D$@$AEU E$M܅tu$4$tuU܍uUD$D$ D$T$D$ D$$,&$d4$juD$D$ D$D$D$ D$D$D$ D$'U1ɉEU ]/ UEU ] U8}}U]uX ÂYGpLE  uFD$D$ D$ D$$ƪ1]u}]Í&D$ G,@HD$F0D$@$z?tkU1$tsD$$u/4$tE 4$h4$1fWD$D$ D$ D$D$ D$UE]@ @fU(]X}uD$H$ |$teƋEFF F?FFD$cyD$D$ D$S|$$.]u}]Í1D$D$ D$K|$$ÐU(]$NWu}D$@U$tKpD$D$<$D$ t$<$D$TbE0]u}]ÍD$D$D$ D$$=1뿉'U(]dÎVu}׉EMUtT|$$uE4$D$Pt 4$1b]u}]Í&E4$D$]ٍD$D$ D$D$$맍'UH]Uu}xUM܋wLSu?D$D$ D$D$$1]u}]D$ GHD$F0D$@$;EUEM܅tq$4$+tqU܍(u2UD$D$D$T$D$ D$$M6v$4$uD$D$ D$D$D$ D$D$D$ D$'U1ɉEU ]? UEU ]U8EU]u}xE SwLZuFD$D$ D$D$$1]u}]Í&D$ GHD$F0D$@$9thUttD$$u24$tE 4$ov4$1]D$D$ D$&D$D$ D$vUSiÓRE$?[]Í'U(}} ]uu(RRGDt#$:t$D$E$>eG@L$<u3D$Et$$tQ]Ћu}]f>D$Et$$uD$D$ D$!&D$D$ D$!D$$1xD$D$ D$D$$ɢ1AfU]EQeU1҉}}uEtGtضضUe3ܶǃ]u}]ÍD$t$$b4$ܶED$ ED$ED$`t}jEt8ǃԶTLD$E$c_Iض=uD$P4$lbED$ED$ ED$CD$4$}}Et&TU(]dÎO}׉uD$$@t/ƍgD$D$<$t]u}]Í1D$D$ D$D$$蟠뽍'UWVS\uNED$ D$D$ZD$UT$$5MEMĉD$lL$ D$E$kt>U D$D$ D$T$M$L$֟1\[^_]Ë}uutrr1E fu9}vXUĉT$M4$L$tۋED$ D$D$<D$U$T$W\1[^_]ËEĉ4$D$E؉D$ ED$}D$t&UhD$D$ D$T$E u}0xE$M܋UHM̋MUȅt=MA$MeʉEEȉUỦD$T$ MUL$$MA@U܋E11 t> t%M UE3M uE bUWVS4$D$ D$Q$D$ D$D$81ҋ]Ћu]Ív'UWVSWÁH} <$t$Gt(Et$<$@D$}EH t$<$ tEt$<$uNUtU<$D$E tED$ <$D$E D$}]u}]ft$<$뤍D$!D$ D$gD$$UWVSM?} L$ML$1ɉ4$3E4$EuED$D$ D$!1D$$34$[^_]Ð|$4$PEue}M뷉4$~i!D$!D$ D$D$$誏4t&tE4$D$uuD$D$ D$D$D$ D$1D$!D$ D$D$$&UWVփ ɉEu t :uIt&1Ut5E UMD$D$ ET$1D$|$$E ^_]ËE UMD$D$ ET$D$D$$1t UuNE VMD$D$D$ ED$D$E$1]7U *\&'US)S<E$cC[]Í'U8]<ɉuΉ}EUtz4$NxME|$$tg>tBNjEt$T$D$D$!D$ D$<$]u}]Íz붍&z{E|$1t$D$ D$"D$!D$JD$$ԌfU1ɉ8U ]E&;uu$UU}} UUUUUUUUt1UM]uuU U}}U‹E]VUBHD$ D$$D$"D$!D$]1u}]Í&UEU M],UWVSlEAXUM2:EED$ AHD$AL@0D$}$ EED$UT$}<$tD$E$t$t l[^_]D$U$c=UE҉ufEU$UBLP8EEExE|$T$D$ L$UĉT$Eȉt$D$ UЉT$E$BEU܉$\UEꀉỦGE}G 9ЉE!#}EUB$ED$ T$}G@HD$F @D$ED$ D$D$U$T$軉F @P t!D$t$F@L$҅EHDt$UET}G$t uUB$t ME11P uE 9x UBT8uH$UEuȍt$D$ D$E$D$跈t$D$ D$#U$T$萈l1[^_]ËG@L$! U"J$UEsUB$t E}G$t E1UBR @LH@BpyE D$ }gD$T$E܉|$D$ED$ UBD$$D$օaUB$ t EE$tEt;}<$tEt%UB B9EsEԋ}E̋?9lj} 1҃}T$ED$}܉<$4zuEHP fMD$D$ D$!D$$諆l1[^_]ÍD$D$ D$‹}Gptt9uU6Bt9N$UEfuԍt$D$ D$}$|$Y}"wD$t$E$#D$ FdVhD$T$}܉<$t$D$ D$lE$D$藅t$D$ D$U$T$pD$D$ D$E@`EċE@\EqU$"J$UE;t$D$ D$}$|$*Ex<$"D$F(D$}<$k$"D$F,D$U$F8D$T$|$ D$F(PLFb@D$T$E܉$"t$D$ D$U$T$t$D$ D$}$|$.t&}|$UBHD$ D$$D$"D$!D$蟃1R$fE{fnBD$ D$D$#D$E$D$Gt$D$ D$}$|$^t$D$ D$U$T$,F @D$G@HD$ D$D$<#D$}$|$蜂EԲEWED$U$!;t$D$ D$}$|$<&t$D$ D$E$D$ GHD$ D${D$#D$U$T$ˁt$D$ D$iU$T$虁t$D$ D$}$|$gx#D$D$ D$E$D$/sv'UWVSEUMFp/D$ AHD$AL@0D$$UED$U4$T$uD$$D$!|$D$ D$ED$$zE1ɉD$D$ D$$Qt?EM̅tED$ED$U$tRČ[^_]Í$$t$|$D$D$ D$U$T$Č1[^_]ËED$ED$ D$D$$D$E$D$Č1[^_]Ít&D$D$ D$!D$$PČ1[^_]ÍvD$D$ D$뾋Ep\P`}̅t\E9D$$ET$t$D$ UBHD$ D$D$D$D$E$D$~1T$11ҍMt$D$ D$D$$)uUB`D$B\D$ D$D$$D$U(]dÎ,uΉ}׉E$uAD$D$ D$!D$$}1ҋ]Ћu}]Í"$EtV$"$Ept\$EWuD$D$ D$jD$D$ D$KD$D$ D$,UWVSU Ee5u1M,V+U}EUMG1;U}@Lp@u&REU@ uD$D$4$}MGTDMt$uD$e4$D$ T$EEE 9E}EGTk@ptxV ҉UtnP }EUe~`UUv\Eu$}Mt$ |$D$ $D$5EEE 9ElyMuIALMы@@EFEmUu}ы6逋9ȉu}u1 f9t;Eu9uLM("t$ủD$ D$ L$D$4$n}t$GD$E$0MQt$ uBHD$BL@0D$$wD$ED$D$D$D$D$ |$$'UUD$$T$=UMErTd1u|$D$D$ T$4$vMuD$ D$D$L$4$Gy$!D$D$ D$t$$y|$D$ D$t$$\y|$D$ D$0t$$8y|$D$ D$Jt$$y1}e3=WĜ[^_]Ë}G@HD$ D$Z$D$%D$!D$x1뤍D$!D$D$ D$U$x1m!|$D$ D$t$$Ox!|$D$ D$t$$x!|$D$ D$t$$w!|$D$ D$t$$wO6UVS u%VLD$ FHD$B0D$@$T t4$D$4- [^]ÍD$!D$D$ D$$w 1[^]Ít&UWVSGq%lEUMECMUEUBt׃t90u&9֋HUEdu!t$D$ D$|$$`vE$t$D$ D$|$$1vEEl[^_]ËEUꀉU9ЉEU11R uhfEă 9x vXUĉBT8uHtދUEuύ!t$D$ D$|$$u*UċEȋ9‰UuED$D$$(EJUED$T$$7}ED$ D$$D$p&D$!D$tEU$!t$D$ D$|$$t@U!BHD$ D$|$D$@%D$$`tU'E$^UBuUBP%=u E$UD$$t$$E ED$$iUD$$t$$EE$$ u0D$!D$ D$D$$|sEUEUEUD$D$$Ar$!UT$UT$ UT$UD$$K1뤋MUE$D$D$ D$!D$$rEEEEUEUD$D$$vt4$TtΉ4$tUED$ED$ ED$|$$jE8tED$$4$Ut$$D$ƋE$?$7u-U!D$ D$D$T$$q!t$D$ D$|$$rqt$D$ D$|$$NqE]U:E8ET$UD$B$L&"D$!D$ D$D$$pEUBHD$ D$$D$%D$!D$pED$D$ D$D$!D$ D$D$$.pDD$D$ D$>|$h%!D$D$ D$|$$oYED$$DUD$$t$$EE$$Eu5D$!D$ D$D$$LobU$t E@}(UD$$ED$$t$$fU$EH$@u0!D$D$ D$|$$nEUEEUUED$T$$stc4$5t҉4$GEtwt >$*t$uE뎋$%uE̅!UBHD$ D$|$D$L&D$$mD$!D$ D$D$$m!D$D$ D$|$$_mt$$jUED$ED$ ED$t$$\tYE؋UD$E܉D$ ED$EЉD$$/thED$ ED$EЉD$$!2G!D$ D$T|$D$%D$$lEЍ!D$ D$X|$D$&D$$PlNt&'UME}U H]fU]ELv}} u<$z!]u}]Ít&'UVU uBP`t^]0ɉ1ɅtEV^]ÍU(]uu }}Bt]u}]$t&D$!D$D$ D$$k]1u}]ÐUWVSMpЋU;}} E҃ EEEEEE$D$D$tt$!hXt$uOD$D$ D$|h1$T$it$kļ[^_]fED$t $EtEUM艍`EMDžxꀉU׍UDž|EE\ldx`D$\T$lL$ dD$xT$t $xEt|$E$获|u{EpU4$T$Yt$pA$<@PtKED$EȉD$ED$|D$pAD$ D$ED$ȃ$҅^EEEE1D$D$ D$h$D$g!D$D$ D$yT$$gy1D$!D$D$ D$v$xgļ[^_]ËEtT|$U$tAMAHD$ D$D$&D$h1$D$g#UċE umȅ]E؋RP,$]EEMU U6"\$D$D$ D$h$L$f}Et<ft5}tq EE MEBtCUxEMAHD$ D$D$&D$EM6uf؃ x ؃ xD$D$ D$UWV΃ ɉUt9uMU1t=E1ɉD$ED$ED$ ED$E D$E$Uj ^_]ËE1҉D$ED$ED$ ED$E D$E$)t ^_]ËE1ҍND$ED$ED$ ED$E D$E$4뵍v'UWVS!E $"!Ɖt$ U BHD$BL@0D$U$]t$E D$U$M&D$!|$D$ D$;ED$$ dED$ED$ED$ U T$ED$$E$t [^_]ÐD$D$ D$>E$D$c1[^_]Í&D$!D$D$ D$2$Pc1[^_]Ít&U BHD$ D$7$D$"D$!D$c1[^_]Ív'UWVS} D$ CGHD$GL@0D$U$|$D$E$!'D$t$D$ D$UT$$QbD$ED$ED$D$D$ $Eft [^_]ÍvD$D$ D$E$D$a1[^_]Í&D$D$ D$!D$$a1[^_]Ít&D$D$ D$뾍t&US虿U[]ÍvUSyã腮[]ÍvUSES}$m[]Ít&'U(]$N}uD$@E"$\D$$ƋE>FE <$D$豸Ft.UF$買]u}]Í&D$!D$ D$D$$ `<$1肹뮍1D$!D$ D$D$$_wD$!D$ D$D$$_닍t&'U]ѽ uu}} E$ ֵE/ % 1҉D$%D$ED$ $膻uLD$D$ D$!1D$$^E$e]u}]ËE$蛵u;d'1D$!D$ D$D$$^룍&ED$E$誶t}tutc1qD$D$ D$:,'1D$!D$ D$D$$] E$芰EEEEE؉EEEEEED$ED$ED$ ED$ED$E$莸EEt}MuUWVS藻 D$ e5u1L$T$D$nD$4$荴D$t$$*uz1'%=(D$t$D$ D$|$$\1Ue3$Ĝ[^_]ÍW8xfȍ@(D$'D$D$ D$$)\1딐t&d(t$D$D$ D$|$$['D$t$D$ D$|$$[4$ðO薨$ܨt$D$ D$|$$D$1D$ϣD$d[1&UWVS胹í |QUD$ |$D$eU1ҍsD$$nzt$D$T$ D$$+-D$T$D$ $D$D$$D$ 'D$谱!D$$T$AuP%= 'D$ D$T$D$)D$$Y$T$D$ͫ%==`*D$D$ D$T$ f(|$D$D$ D$x'D$$ Y1Ue3r|Q[^_]Í$)t$D$D$ D$뭍`)t$D$D$ D$'D$ D$'T$D$D$t$$RXD$$֫D$$8)|$D$D$ D$.'0D$$D$Jd$T$D$"<TP31 H,*D$D$ D$T$'D$$W'D$D$ D$T$D$$V$6賣$D$ D$$T$D$1D$D$ϣD$uV1dD$D$ D$$D$>V1-$腩''$[PpC9u D:Ft~9u~:Fu~:Ftt$D$D$ T$<$ЮD$|$$苧J%=`4|$D$ T$D$D$g$T<$ԡ$|$D$ D$iT$$D$1D$ϣD$T&'D$t$D$ D$`D$$\TZ>$脡D$ D$U$T$D$~D$ϣD$'D$S'D$ D$T$D$$T$S$貨腠$ˠD$ D$$T$D$1D$ϣD$D$GS*D$D$ D$T$$FD$ D$t$$D$(D$D$ϣD$R1D$ D$T$D$$+D$$RvUX}׋U]詰u΋MU eU1҃r+Ue3]u}]ÍsD$t$|$ D$$V$S$S'eD$D$ D$$D$_Q13't$s|$ D$D$4$艨tf4$4$ )(D$'D$t$D$ D$E$P4$h}+D$'D$ D$@D$$lPD$D$ D$T$$zt$t$E$M1҅uI]Ћu}]ËEMu]EM }FHuE]t&UBLH0t$ut$uFH$1t1҅낍t&'U$t$uUM uzEE $t$]Uuu]螨FLH0zD$D$FH$]u]Uuu]NxFLH0zD$E D$FH$1z]u]U1S1tED$E D$E$҃[]ÍUSɧtЃ[]ÍU(]蔧þuu}tI+D$,D$D$ D$A$ I]u}]Í&F FF ,D$,D$E $U D$ $Ǎn3D$|$ ‰e,D$$G-D$$!-D$$ -D$$՚,-D$$诚,UU,D$|$D$ T$D$`$GU t$BP$D$g,D$,D$|$D$ D$V$7G$Ֆ1ǃD$,D$D$ D$N$F1@,|$D$D$ D$^T$$F&'US٤tЋ$ ǃǃǃǃǃ[]ÐUuu ]}}U>/th;-D$ED$$|tGD$ zD$Et$<$D$Bt!ED$|$$Fut&Et$<$D$ٔ]u}]UH]E讣uu }}eU1҉T$t$<$N-D$ D$ D$7D$_-T$D$|$$DD$$詚tUe3]u}]ËEt t&WD$ D$?|$T$$D$D$-D$9D뀋t$1D$ D$1D$|-D$N-D$$C;ɜD$ D$<|$T$$D$D$-D$C1q% ЉU]  Ð&UVƍt&t9t vpu^]fpۍt&'UE M‹E1ҋtPɉÍvUE]@Ðt&U‹@u]UE@t]]1ÍUEPt]뼋@ t;w] U]ĠuuD$4$袝t 0@]u] U8]E qÛu}~MNjEƸt]u}]fUD$$t%8EBBBEB 뱍D$-D$D$ D$[$A1zU8E4U ]u,4}}ç0px 8e M1ɉ(t8:u&1Me3 ]u}]Ðt&[-1҉%11 1- $$11 k0D$Ɖ1 L$% D$8L$ D$ -D$$i@D$$D$ad D$$谏<<}D$@<$T$E!(,<$D$T$豙tP4 $ 0|$D$ D$T$$D$.D$.D$>< $ ϋ$D$ D$$D$ D$D$ϣD$.D$>4D$8L$$ lk&7N$tD$ D$$T$D$_zD$ϣD$.D$=/0.D$D$ D$L$.D$$=蓊$يD$ D$$D$kzD$D$ϣD$.D$U=Z71${D$ D$$L$D$`.D$ϣD$.D$<0D$ % ЋD$8L$$D$ /.D$0C.D$D$ D$L$vUX]E葚û}} D$uE-$EBt1]u}]Íu<$՛BT$t$D$ D$$D$f.D$.EԉD$;U ҉Ut.$EMM؉L$BE Yu<$EBT$t$D$ D$$D$.D$EԉD$&;U҉UM؍o$EEL$.u<$轚.T$t$D$ D$$D$.D$EԉD$:U|} wM@/<$1UUMD$ D$4T$L$D$.D$$=:#Ћu܉<$D$ D$< T$D$/D$E$D$9B뮍B머롍&U8].uuT$t$D$ L$$1҅t 1ҁ}N+‹]Ћu]ÍUWVS觗&'USU0M 0[]&'USUօM 0[]UE]@ @fU(]蔅þ}uD$^$ !1|$wttƋEUF?FE D$B$*FF `FD$cyD$D$ D$i|$$&]u}]Í1D$D$ D$a|$$&fUS蹄E$x[]Í'USE 胄íU$D$ET$$Ax[] UWVSGq,u D$ D$($31D$!1ED$%EuEEEE@EU}Ut؋u tƋuCtu tEUD$D$B@L@$ Rt,1[^_]D$4$i$`$BaD$ D$`D$3D$d3D$ϣD${`8t&'U]q }ljD$uD$ D$33D$v30D$$UD$4$mt!4$j]u}]Ít&ED$|$$auč4D$t$$luUME3E1 uU8E341 x<$gh_$_|$D$ D$9$D$1D$ϣD$0D$Xv7_$}_|$D$ D$<$D$!D$ϣD$0D$v'UWVS'pQv3U:fVF F $c4$cE;}NjMtF U$T${muԉ4$mUtF D$ D$JD$3D$E$D$D$ F$QkM]$*^D$3D$F D$ D$LD$ϣD$U$T$<1[^_]Ã<[^_]U1҉1]vU1]USnӾ$D$$^ĸu$[]ÍķǃĸD$D$$h$D$^u\$$]D$ D$p$D$3D$3D$ϣD$v3D$[t&'UWVSm},(R" $T$v3D$,D$ D$D$3D$ T$$[0[$$$T$+iƋ08ED$,$T$L]hu/(~$eD$D$B,$i(+}OLǃĸD$$3\DD$D$$eD$$B\$T$($hƋ08M08<$ZD$3D$,ϣD$D$ D$T$ $D$] ($d1[^_]Í4D$($D$*gnUME3E1 XU8E341 <0$ZD$!D$,D$ D$D$ϣD$ $T$ ǃĸD$D$ D$ $D$> 1[^_]úW0$SYD$D$,D$ D$D$ϣD$ $T$ 1[^_]fUWVS,iEeE1U܋UME$B`#)ċE|$<$D$Da<$`U:aux@$t&}t6UxEM؋U܉$EƋUe3u,e[^_]ËUE$UVUƉ*c8vUXE ]eU1hEuu}tcD$D$v3D$D$ D$:$V 1Ue3]u}]Í&6E:#R$D$ 3T$D$D$$2&'USb4D$v3D$ D$vD$$Y[]ÐU]Ít&'U]Ít&'U]Ít&'U҉t1&9u]Í&UWVSE U +bU9Љx4df4D$D$ D$ld$D$|1D$ D$D$`6D$d$T$TxB $賈#xG $cD$ D$D$5D$d$D$M x9xF $躑xB $bxxwI|MD$sd4$T$REEEt$D$<$1RxD$<$D$VxB $axMt$$UMD$06T$L$ MD$D$ D$~L$d$D$d|$t$ MUL$T$xA $<$S|$D$ D$d$t$M|$D$ D$d$L$yt&<$Sxxxxw1B Mu}$`|$ D$$t$D$M6D$D$ D$L$d$t$dE,}D$ |$EUD$T$xB $莕ExF$V(ƨu9}1ƉUEE};}U썓6E艕`xA $_D$$t$|$ D$ED$`D$ D$T$d$L$aED$ t$|$D$xB $薔bME 9MƀEUEU9U5xB $^D$ D$D$05D$d$L$|6D$D$ D$L$d$t$1k6D$D$ D$ud$L$6t$|$D$ D$$|5t$1D$D$ L$D$$x[^_]Í|$D$ D$d$D$|$D$ D$d$t$b1[^_];E`l9Et&}Ixw,1}uD$xB0t$|$D$ B $]xxM9ʉU1ҋxiHw01t׉pƁH9tPTC9p07\+EUMEȉŰxMċR Uԉ$#\D$(Huȋ}̉t$ |$$D$}ĉ|$ED$\D$ D$,D$d$T$|$D$ H}̋uȉ|$t$}ԉ<$EjEU9ЉEJE1҉׋iHƁHTxPw01Tlhw 9PL5L$D$D$ D$Gd$D$ |c51D$D$ D$|$d$D$x|$D$ D$ d$T$xG $fZD$ D$@D$7D$d$D$R@x1҉U܋EA4E؋A $YML$$U؋M܉D$`7T$L$ MD$D$ D$ZL$d$t$x|$UT$ E؋U܉D$T$xB $|$D$ D$^d$T$Z|~5D$D$ D$L$|$D$ D$0d$L$|$D$ D$Ld$t$xat&UWVS<8V EU9B<4EU ?;}wű4$D$볍D$D$ D$| U8]E S uu};E 8HtK4$[UD$ D$$D$7D$4D$G1]u}]ÀxMuU BftUf54$TU D$BD$ D$$D$7D$4D$1닋M A$A( } Ltg U |,=uM T,1  tBu !t1҃?]T#Ã7]ЉÃ=Ɛ&UWVSE U}uE1U1EðU$;EPOOL@0000@0000f@ 00@fE?EUD UE EUuf1?UDu1E?UDmu[^_]ÍUWVS,MEEDݔQffNjE EffMxEQ AffEыUffMM EQ ʉAE$D$D$]:UM ffffffff ff $ff$(,ffEыUffMM E,U(0ff04ff48ff8<ff<@ff@DffDEHD$$HD$8,[^_]É'UWVS,M EEsBÝQffNjEEffM xEQ AffEыUffMMEQ ʉAE $D$D$8U Mffffffff ff $ff$(,ffEыUffMME,U (0ff04ff48ff8<ff<@ff@DffDE HD$$HD$6,[^_]É'UWVSEMu8@bU tEltpeU1҉hE| $D$X|Ẻx D$D$ BR D$xT$$xUdT$D$' $vl$Ad 9`L$D$ T$D$^D$%9\D$$|D$D$ AQ 4$D$T$Rd4$D$'D$خtd`\T$L$D$|$D$ D$b$alxpt$D$|$ T$L$$ht Fh|(ff F(FF,$,tlf0ǁʉ,É  EЉBEԉBE؉B E܉BEBEBEBUe3u?ļ[^_]Ë\D$D$ D$fT$$:1 UWVSg=Ñ<Eu eU1ҋ}4$m2<$D$0*/D$D$ D$D$4$wD$t$T$ B<$D$aus%9t$D$ D$2|$$=|$1t$D$ D$j$Ue3<[^_]É4$bcu׍D$%9D$ D$mD$$륍1D$%9D$ D$bD$$n4$%9W=D$ D$-|$$D$8D$CL9D$%9D$ D$eD$$ t&UWVSEU +;UMEEEUeU1҉ME%9EMEE0UD$$qE@<9D$$4E"MEIE9M~UEEEUt&MQ$t+MAT$UD$ E$D$E?uU9UM99E E f?9}U t$$耪t܋MD$'4$L$襩U,$aM,$+;UƋ,$xMt$D$ D$IL$$D$5D$ED$<$p7UMT$ $0U 9EvMu M$E9EE}1t1U4;EuM $3Mt ExU$e'E}MUL$B$MD$E$n*UE9U7uOU,$9MD$ D$D$L$D$7D$ED$M9D$%9D$D$ L$D$R$v1Ue3Ĝ[^_]ËM $z29t UčD$%9D$ D$D$$Ut9t$D$D$ D$T$$M $32NE$#2>=U; W1V}EWف9Eɴ fEm}mEP,$؉9m}mE ^_]ÐU W1V}EWف9Eɴ fEm}mEP,$؉9m}mE ^_]ÐUWVP} EUEuEEUEkMNM҉M܉E؉Uԉu}u(9 UEM܋EUQE9Ev6uU}MUMt&Eąt ]U]EUP^_]fEԃE U+Eȋ}؋uEEM ‹EMЉUUM ЋUMuU9U;UM)щMMȉEMM ‹EUUEE܋MH0U؅t>E̋UE&EU؃ރE1u؉봋M9MwE9EsEỦEUŰM+MUԉMU91)U'UWVEU} EE҉։Eu9ȉ^_]Ðt&9ƒEt U+EME ‹EUMEEMM uщNjE9щƉUro9t^1yEt2ƋE^9w*U9Us"f11G&1uf1$EM9vO1 UWV0UEu} EEEUu}u9UEfM9MvuЉ}fEЋUԃ0^_]ÍvEE U+E܋}uEEM ‹EMUUM ЋUMuU9U;UM)щMM܉EMM ‹ẺUENEtEUEt&1ufE9EwU9UsUMUЉMME+EMEM9d)UZU]Ít&'UWVS1AkE)E}Ut+1ƍED$E D$E$9}u߃[^_]ÐUS0Ӏ*USt Ћu[]US[È0/Y[dumpconfig.cNeed 1 or more of -a, -C, -j, -m, -M, -p, -r, --resync, --refresh, --alloc, --addtag, --deltag or --monitorOnly -a permitted with --ignorelockingfailurePlease give logical volume path(s)--major and --minor require -MyOnly give one logical volume when specifying minorOnly one of --alloc and --contiguous permittedMinor number is already not persistent for "%s"Disabling persistent device number for "%s"Minor number must be specified with -MyMajor number must be specified with -MyLogical volume %s will be deactivated temporarily. Continue? [y/n]: Setting persistent device number to (%d, %d) for "%s"Updating logical volume "%s" on disk(s)Re-activating logical volume "%s"Logical volume %s/%s does not support tagsFailed to remove tag %s from %s/%sUnable to resync %s because it is not mirrored.Unable to resync pvmove volume %sUnable to resync locked volume %sCan't resync open logical volume "%s"Do you really want to deactivate logical volume %s to resync it? [y/n]: Logical volume "%s" not resyncedUnable to deactivate %s for resyncCan't get exclusive access to clustered volume %sStarting resync of %s%s%s mirror "%s"Failed to reactivate %s to resynchronize mirrorFailed to write intermediate VG metadata.Failed to commit intermediate VG metadata.Unable to activate %s for mirror log resyncUnable to reset sync status for %sFailed to deactivate log LV after wiping failedUnable to deactivate log LV %s after wiping for resyncFailed to update metadata on disk.Failed to reactivate %s after resyncDeactivating logical volume "%s" locallyDeactivating logical volume "%s"Activating logical volume "%s" exclusivelyActivating logical volume "%s" locallyActivating logical volume "%s"Only -a permitted with read-only volume group "%s"Can't change logical volume "%s" under snapshotCan't change snapshot logical volume "%s"Use 'pvmove --abort' to abandon a pvmoveUnable to change mirror log LV %s directlyUnable to change mirror image LV %s directlyUnable to change internal LV %s directlyLogical volume "%s" is already writableLogical volume "%s" is already read onlyCannot change permissions of mirror "%s" while active.Setting logical volume "%s" read/writeSetting logical volume "%s" read-onlyUpdating permissions for "%s" in kernelAllocation policy of logical volume "%s" is already %sSetting contiguous allocation policy for "%s" to %sMetadata only supports readahead values between 2 and 120.WARNING: Overriding readahead to %u sectors, a multiple of %uK page size.Read ahead is already auto for "%s"Read ahead is already %u for "%s"Setting read ahead to %u for "%s"Refreshing logical volume "%s" (if active)Logical volume, %s, is not activelvchange.c%s device number not changed.Ensuring %s is inactive.%s: deactivation failed%s: reactivation failedFailed to get tagFailed to add tag %s to %s/%score-loggeddisk-loggedClearing log device %sUnable to change pvmove LV %sFailed to lock %sProblem reactivating %sLogical volume "%s" changed%s_mimage_%%dlvconvert.c_mimagetmp_%dlayer name allocation failed.Failed to insert resync layerCannot convert locked LV %slockedpvmovemirroredWARNING: "%s" not zeroedCouldn't deactivate LV %s.Couldn't create snapshot.Failed to suspend origin %scoreUnknown mirrorlog type: %sSetting logging type to %sallocateUpdating "%s" in kernelLogical volume %s converted.Convertedactivation/mirror_region_sizemirrorlvconvert: layer name allocation failed.lvconvert: layer name generation failed.%d missing and now unallocated Physical Volumes removed from VG.Can't convert logical volume "%s" under snapshotCan't convert snapshot logical volume "%s"Unable to convert pvmove LV %sCan't repair non-mirrored LV "%s".Unable to convert mirrored LV "%s" into a snapshot.Couldn't find origin volume '%s'.Unable to use "%s" as both snapshot and origin.Unable to create a snapshot of a %s LV.Aborting. Failed to wipe snapshot exception store.Problem reactivating origin %sLogical volume %s converted to snapshot.You may only use one of --mirrors and --repair.The mirror is consistent. Nothing to repair.Mirror status: %d of %d images failed.Allocation of list of failed_pvs failed.Allocation of failed_pvs list entry failed.Logical volume %s only has %u mirrors.--mirrorlog disk and --corelog are incompatibleMirror log region size cannot be changed on an existing mirror.Logical volume %s has multiple mirror segments.activation/mirror_image_fault_policyAttempt to replace failed mirror log? [y/n]: Attempt to replace failed mirror images (requires full device resync)? [y/n]: Logical volume %s is already not mirrored.Mirrors of striped volumes are not yet supported.Can't add mirror to out-of-sync mirrored LV: use lvchange --resync first.Can't add additional mirror images to mirrors that are under snapshotsABORTING: Failed to remove temporary mirror layer %s.Manual cleanup with vgcfgrestore and dmsetup may be required.Logical volume %s already has %u mirror(s).--snapshot argument cannot be mixed with --mirrors, --repair or --log--regionsize is only available with mirrorsNegative chunk size is invalidChunk size must be a power of 2 in the range 4K to 512KSetting chunksize to %d sectors.--chunksize is only available with snapshots--zero is only available with snapshotsNegative regionsize is invalidNegative regionsize in configuration file is invalidRegion size (%u) must be a multiple of machine memory page size (%d)Region size (%u) must be a power of 2Non-zero region size must be supplied.%s: Required device-mapper target(s) not detected in your kernelPlease specify a logical volume to act as the snapshot origin.The origin name should include the volume group.Please provide logical volume pathPlease use a single volume group name ("%s" or "%s")Please provide a valid volume group nameChecking for existing volume group "%s"Logical volume "%s" not found in volume group "%s"Conversion starts after activationFailed to remove temporary sync layer.stripedlvcreate.cNegative size is invalidmetadata/stripesizeUsing default stripesize %sInvalid stripe size %sFinding volume group "%s"Redundant stripes argument: default is 1Redundant mirrors argument: default is 0Mirrors argument may not be negative-Z is incompatible with snapshots-c is only available with snapshotsmirrors and snapshots are currently incompatiblemirrors and stripes are currently incompatible--corelog is only available with mirrors--nosync is only available with mirrorsPlease provide a volume group nameVolume group name expected (no slash)Inconsistent volume group names given: "%s" and "%s"Volume group name %s has invalid charactersLogical volume name "%s" is invalidPlease specify either size or extents (not both)Negative number of extents is invalidNegative virtual origin size is invalidVirtual origin size may not be zeroNegative stripesize is invalidStripe size cannot be larger than %sIgnoring stripesize argument with single stripeNumber of stripes (%d) must be between %d and %dConflicting contiguous and alloc argumentsOnly up to 8 leg mirrors supported currently.Please specify minor number with --minor when using -MyPlease specify major number with --major when using -My--major and --minor incompatible with -MnPlease express size as %%VG, %%PVS, or %%FREE.Incompatible options selectedlvdisplay.cOptions -v and -c are incompatibleWith LVM2 and the device mapper, this program is obsolete.lvmchange.crwwreyyelnnlylAvailable lvm commands:lvmcmdline.c%-16.16s%sstub.hCommand not implemented yet.2.02.56(1)-RHEL5 (2010-02-08)LVM version: %sLibrary version: %sDriver version: %sCouldn't allocate memory.Out of memory.Dump active configurationdumpconfigformats formatshelp Display help for commandslvchangeChange logical volume layoutlvconvertCreate a logical volumelvcreatelvdisplayAdd space to a logical volumelvextendlvmchangelvmdiskscanCollect activity datalvmsadcCreate activity reportlvmsarlvreducelvremoveRename a logical volumelvrenameResize a logical volumelvresizelvslvscanpvchangeResize physical volume(s)pvresizepvckpvcreatepvdatapvdisplaypvremovepvsList all physical volumespvscansegtypes List available segment typesvgcfgbackupvgcfgrestorevgchangevgckvgconvertCreate a volume groupvgcreatevgdisplayvgexportvgextendvgimportMerge volume groupsvgmergevgmknodesvgreduceRemove volume group(s)vgremoveRename a volume groupvgrenamevgsSearch for all volume groupsvgscanvgsplitversion noneVGPVPVSFFR%s: no such command.%s: %s %sCouldn't copy command line.Parsing: %s -Option requires argument.Invalid argument %sInvalid units specificationCompleted: %sUnrecognised option.Processing: %sO_DIRECT will be usedlvm.staticinitrd-lvm/proc/%u/cmdlineLVM_SUPPRESS_FD_WARNINGS/proc/self/fd/%u Parent PID %d: %s /usr/sbin/lvmLVM_DID_EXECglobal/fallback_to_lvm12.4.%s.lvm1execvp%s: %s failed: %sPlease supply an LVM command.Too many arguments: %squitexitfcloseNo such command. Try 'help'.--version--quiet--setphysicalvolumesize--ignorelockingfailure--nolocking--pvmetadatacopies--metadatacopies--metadatasize--restorefile--labelsector--driverloaded--aligned--unbuffered--noheadings--segments--units--nosuffix--removemissing--abort--addtag--deltag--refresh--mknodes--minor--type--alloc--separator--mirrorsonly--nosync--resync--corelog--mirrorlog--repair--use-policies--monitor--config--trustcache--ignoremonitoring--nameprefixes--unquoted--rows--dataalignment--dataalignmentoffset--virtualoriginsize--virtualsize--noudevsync--resizable--allocation--available--all--autobackup--activevolumegroups--background--blockdevice--chunksize--clustered--colon--columns--contiguous--debug--exported--physicalextent--file--force--full--help--stripesize--stripes--interval--iop_version--logicalvolume--maxlogicalvolumes--extents--lvmpartition--list--size--logicalextent--persistent--major--mirrors--metadatatype--maps--name--oldpath--nofsck--novolumegroup--options--sort--permission--maxphysicalvolumes--partial--physicalvolume--readahead--resizefs--reset--regionsize--physicalextentsize--stdin--snapshot--short--test--uuid--uuidlist--verbose--volumegroup--allocatable--resizeable--yes--zerokmgtpebsUse 'lvm help ' for more information%s and %s are synonyms. Please only supply one.There's no 'pvdata' command in LVM2.Use lvs, pvs, vgs instead; or use vgcfgbackup and read the text file backup.Metadata in LVM1 format can still be displayed using LVM1's pvdata command.WARNING: Running as a non-root user. Functionality may be unavailable.dumpconfig [-f|--file filename] [ConfigurationVariable...] List available metadata formatslvchange [-A|--autobackup y|n] [-a|--available [e|l]y|n] [--addtag Tag] [--alloc AllocationPolicy] [-C|--contiguous y|n] [-d|--debug] [--deltag Tag] [-f|--force] [-h|--help] [--ignorelockingfailure] [--ignoremonitoring] [--monitor {y|n}] [--noudevsync] [-M|--persistent y|n] [--major major] [--minor minor] [-P|--partial] [-p|--permission r|rw] [-r|--readahead ReadAheadSectors|auto|none] [--refresh] [--resync] [-t|--test] [-v|--verbose] [-y|--yes] [--version] LogicalVolume[Path] [LogicalVolume[Path]...] Change the attributes of logical volume(s)lvconvert [-m|--mirrors Mirrors [{--mirrorlog {disk|core}|--corelog}]] [--repair [--use-policies]] [-R|--regionsize MirrorLogRegionSize] [--alloc AllocationPolicy] [-b|--background] [-d|--debug] [-f|--force] [-h|-?|--help] [-i|--interval seconds] [--noudevsync] [-v|--verbose] [-y|--yes] [--version] LogicalVolume[Path] [PhysicalVolume[Path]...] lvconvert [-s|--snapshot] [-c|--chunksize] [-d|--debug] [-h|-?|--help] [--noudevsync] [-v|--verbose] [-Z|--zero {y|n}] [--version] OriginalLogicalVolume[Path] SnapshotLogicalVolume[Path] lvcreate [-A|--autobackup {y|n}] [--addtag Tag] [--alloc AllocationPolicy] [-C|--contiguous {y|n}] [-d|--debug] [-h|-?|--help] [-i|--stripes Stripes [-I|--stripesize StripeSize]] {-l|--extents LogicalExtentsNumber | -L|--size LogicalVolumeSize[bBsSkKmMgGtTpPeE]} [-M|--persistent {y|n}] [--major major] [--minor minor] [-m|--mirrors Mirrors [--nosync] [{--mirrorlog {disk|core}|--corelog}]] [-n|--name LogicalVolumeName] [--noudevsync] [-p|--permission {r|rw}] [-r|--readahead ReadAheadSectors|auto|none] [-R|--regionsize MirrorLogRegionSize] [-t|--test] [--type VolumeType] [-v|--verbose] [-Z|--zero {y|n}] [--version] VolumeGroupName [PhysicalVolumePath...] lvcreate { {-s|--snapshot} OriginalLogicalVolume[Path] | [-s|--snapshot] VolumeGroupName[Path] --virtualsize VirtualSize} [-c|--chunksize] [-A|--autobackup {y|n}] [--addtag Tag] [--alloc AllocationPolicy] [-C|--contiguous {y|n}] [-d|--debug] [-h|-?|--help] [-i|--stripes Stripes [-I|--stripesize StripeSize]] {-l|--extents LogicalExtentsNumber[%{VG|LV|PVS|FREE}] | -L|--size LogicalVolumeSize[bBsSkKmMgGtTpPeE]} [-M|--persistent {y|n}] [--major major] [--minor minor] [-n|--name LogicalVolumeName] [--noudevsync] [-p|--permission {r|rw}] [-r|--readahead ReadAheadSectors|auto|none] [-t|--test] [-v|--verbose] [--version] [PhysicalVolumePath...] lvdisplay [-a|--all] [-c|--colon] [-d|--debug] [-h|--help] [--ignorelockingfailure] [-m|--maps] [--nosuffix] [-P|--partial] [--units hHbBsSkKmMgGtTpPeE] [-v|--verbose] [--version] [LogicalVolume[Path] [LogicalVolume[Path]...]] lvdisplay --columns|-C [--aligned] [-a|--all] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-P|--partial] [--segments] [--separator Separator] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [-v|--verbose] [--version] [LogicalVolume[Path] [LogicalVolume[Path]...]] Display information about a logical volumelvextend [-A|--autobackup y|n] [--alloc AllocationPolicy] [-d|--debug] [-f|--force] [-h|--help] [-i|--stripes Stripes [-I|--stripesize StripeSize]] {-l|--extents [+]LogicalExtentsNumber[%{VG|PVS|FREE}] | -L|--size [+]LogicalVolumeSize[bBsSkKmMgGtTpPeE]} [-m|--mirrors Mirrors] [-n|--nofsck] [--noudevsync] [-r|--resizefs] [-t|--test] [--type VolumeType] [-v|--verbose] [--version] LogicalVolume[Path] [ PhysicalVolumePath... ] lvmchange [-d|--debug] [-h|--help] [-R|--reset] [-v|--verbose] [--version] With the device mapper, this is obsolete and does nothing.lvmdiskscan [-d|--debug] [-h|--help] [-l|--lvmpartition] [--version] List devices that may be used as physical volumeslvmsadc [-d|--debug] [-h|--help] [-v|--verbose] [--version] [LogFilePath] lvmsar [-d|--debug] [-f|--full] [-h|--help] [-s|--stdin] [-v|--verbose] [--version] LogFilePath lvreduce [-A|--autobackup y|n] [-d|--debug] [-f|--force] [-h|--help] {-l|--extents [-]LogicalExtentsNumber[%{VG|LV|FREE}] | -L|--size [-]LogicalVolumeSize[bBsSkKmMgGtTpPeE]} [-n|--nofsck] [--noudevsync] [-r|--resizefs] [-t|--test] [-v|--verbose] [-y|--yes] [--version] LogicalVolume[Path] Reduce the size of a logical volumelvremove [-A|--autobackup y|n] [-d|--debug] [-f|--force] [-h|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] LogicalVolume[Path] [LogicalVolume[Path]...] Remove logical volume(s) from the systemlvrename [-A|--autobackup {y|n}] [-d|--debug] [-h|-?|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] { OldLogicalVolumePath NewLogicalVolumePath | VolumeGroupName OldLogicalVolumeName NewLogicalVolumeName } lvresize [-A|--autobackup y|n] [--alloc AllocationPolicy] [-d|--debug] [-f|--force] [-h|--help] [-i|--stripes Stripes [-I|--stripesize StripeSize]] {-l|--extents [+|-]LogicalExtentsNumber[%{VG|LV|PVS|FREE}] | -L|--size [+|-]LogicalVolumeSize[bBsSkKmMgGtTpPeE]} [-n|--nofsck] [--noudevsync] [-r|--resizefs] [-t|--test] [--type VolumeType] [-v|--verbose] [--version] LogicalVolume[Path] [ PhysicalVolumePath... ] lvs [-a|--all] [--aligned] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--nameprefixes] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-P|--partial] [--rows] [--segments] [--separator Separator] [--trustcache] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [--unquoted] [-v|--verbose] [--version] [LogicalVolume[Path] [LogicalVolume[Path]...]] Display information about logical volumeslvscan [-a|--all] [-b|--blockdevice] [-d|--debug] [-h|-?|--help] [--ignorelockingfailure] [-P|--partial] [-v|--verbose] [--version] List all logical volumes in all volume groupspvchange [-a|--all] [-A|--autobackup y|n] [-d|--debug] [-h|--help] [-t|--test] [-u|--uuid] [-x|--allocatable y|n] [-v|--verbose] [--addtag Tag] [--deltag Tag] [--version] [PhysicalVolumePath...] Change attributes of physical volume(s)pvresize [-d|--debug] [-h|-?|--help] [--setphysicalvolumesize PhysicalVolumeSize[bBsSkKmMgGtTpPeE] [-t|--test] [-v|--verbose] [--version] PhysicalVolume [PhysicalVolume...] pvck [-d|--debug] [-h|--help] [--labelsector sector] [-v|--verbose] [--version] PhysicalVolume [PhysicalVolume...] Check the consistency of physical volume(s)pvcreate [--restorefile file] [-d|--debug] [-f[f]|--force [--force]] [-h|-?|--help] [--labelsector sector] [-M|--metadatatype 1|2] [--pvmetadatacopies #copies] [--metadatasize MetadataSize[bBsSkKmMgGtTpPeE]] [--dataalignment Alignment[bBsSkKmMgGtTpPeE]] [--dataalignmentoffset AlignmentOffset[bBsSkKmMgGtTpPeE]] [--setphysicalvolumesize PhysicalVolumeSize[bBsSkKmMgGtTpPeE] [-t|--test] [-u|--uuid uuid] [-v|--verbose] [-y|--yes] [-Z|--zero {y|n}] [--version] PhysicalVolume [PhysicalVolume...] Initialize physical volume(s) for use by LVMpvdata [-a|--all] [-d|--debug] [-E|--physicalextent] [-h|-?|--help] [-L|--logicalvolume] [-P[P]|--physicalvolume [--physicalvolume]] [-U|--uuidlist] [-v[v]|--verbose [--verbose]] [-V|--volumegroup] [--version] PhysicalVolume [PhysicalVolume...] Display the on-disk metadata for physical volume(s)pvdisplay [-c|--colon] [-d|--debug] [-h|--help] [--ignorelockingfailure] [-m|--maps] [--nosuffix] [-s|--short] [--units hHbBsSkKmMgGtTpPeE] [-v|--verbose] [--version] [PhysicalVolumePath [PhysicalVolumePath...]] pvdisplay --columns|-C [--aligned] [-a|--all] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [--separator Separator] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [-v|--verbose] [--version] [PhysicalVolumePath [PhysicalVolumePath...]] Display various attributes of physical volume(s)pvmove [--abort] [-A|--autobackup {y|n}] [--alloc AllocationPolicy] [-b|--background] [-d|--debug] [-h|-?|--help] [-i|--interval seconds] [--noudevsync] [-t|--test] [-v|--verbose] [--version] [{-n|--name} LogicalVolume] SourcePhysicalVolume[:PhysicalExtent[-PhysicalExtent]...]} [DestinationPhysicalVolume[:PhysicalExtent[-PhysicalExtent]...]...] Move extents from one physical volume to anotherpvremove [-d|--debug] [-f[f]|--force [--force]] [-h|-?|--help] [-t|--test] [-v|--verbose] [-y|--yes] [--version] PhysicalVolume [PhysicalVolume...] Remove LVM label(s) from physical volume(s)pvs [-a|--all] [--aligned] [-d|--debug] [-h|-?|--help] [--ignorelockingfailure] [--nameprefixes] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-P|--partial] [--rows] [--segments] [--separator Separator] [--trustcache] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [--unquoted] [-v|--verbose] [--version] [PhysicalVolume [PhysicalVolume...]] Display information about physical volumespvscan [-d|--debug] {-e|--exported | -n|--novolumegroup} [-h|-?|--help] [--ignorelockingfailure] [-P|--partial] [-s|--short] [-u|--uuid] [-v|--verbose] [--version] vgcfgbackup [-d|--debug] [-f|--file filename] [-h|-?|--help] [--ignorelockingfailure] [-P|--partial] [-v|--verbose] [--version] [VolumeGroupName...] Backup volume group configuration(s)vgcfgrestore [-d|--debug] [-f|--file filename] [-l[l]|--list [--list]] [-M|--metadatatype 1|2] [-n|--name VolumeGroupName] [-h|--help] [-t|--test] [-v|--verbose] [--version] VolumeGroupNameRestore volume group configurationvgchange [-A|--autobackup {y|n}] [--alloc AllocationPolicy] [-P|--partial] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--ignoremonitoring] [--monitor {y|n}] [--noudevsync] [--refresh] [-t|--test] [-u|--uuid] [-v|--verbose] [--version] {-a|--available [e|l]{y|n} | -c|--clustered {y|n} | -x|--resizeable {y|n} | -l|--logicalvolume MaxLogicalVolumes | -p|--maxphysicalvolumes MaxPhysicalVolumes | -s|--physicalextentsize PhysicalExtentSize[bBsSkKmMgGtTpPeE] | --addtag Tag | --deltag Tag} [VolumeGroupName...] Change volume group attributesvgck [-d|--debug] [-h|--help] [-v|--verbose] [--version] [VolumeGroupName...] Check the consistency of volume group(s)vgconvert [-d|--debug] [-h|--help] [--labelsector sector] [-M|--metadatatype 1|2] [--pvmetadatacopies #copies] [--metadatasize MetadataSize[bBsSkKmMgGtTpPeE]] [-t|--test] [-v|--verbose] [--version] VolumeGroupName [VolumeGroupName...] Change volume group metadata formatvgcreate [-A|--autobackup {y|n}] [--addtag Tag] [--alloc AllocationPolicy] [-c|--clustered {y|n}] [-d|--debug] [-h|--help] [-l|--maxlogicalvolumes MaxLogicalVolumes] [-M|--metadatatype 1|2] [-p|--maxphysicalvolumes MaxPhysicalVolumes] [-s|--physicalextentsize PhysicalExtentSize[bBsSkKmMgGtTpPeE]] [-t|--test] [-v|--verbose] [--version] [ PHYSICAL DEVICE OPTIONS ] VolumeGroupName PhysicalDevicePath [PhysicalDevicePath...] vgdisplay [-A|--activevolumegroups] [-c|--colon | -s|--short | -v|--verbose] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--nosuffix] [-P|--partial] [--units hHbBsSkKmMgGtTpPeE] [--version] [VolumeGroupName [VolumeGroupName...]] vgdisplay --columns|-C [--aligned] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-P|--partial] [--separator Separator] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [--verbose] [--version] [VolumeGroupName [VolumeGroupName...]] Display volume group informationvgexport [-a|--all] [-d|--debug] [-h|--help] [-v|--verbose] [--version] VolumeGroupName [VolumeGroupName...] Unregister volume group(s) from the systemvgextend [-A|--autobackup y|n] [-d|--debug] [-h|--help] [-t|--test] [-v|--verbose] [--version] [ PHYSICAL DEVICE OPTIONS ] VolumeGroupName PhysicalDevicePath [PhysicalDevicePath...] Add physical volumes to a volume groupvgimport [-a|--all] [-d|--debug] [-f|--force] [-h|--help] [-t|--test] [-v|--verbose] [--version] VolumeGroupName... Register exported volume group with systemvgmerge [-A|--autobackup y|n] [-d|--debug] [-h|--help] [-l|--list] [-t|--test] [-v|--verbose] [--version] DestinationVolumeGroupName SourceVolumeGroupName vgmknodes [-d|--debug] [-h|--help] [--ignorelockingfailure] [--refresh] [-v|--verbose] [--version] [VolumeGroupName...] Create the special files for volume group devices in /devvgreduce [-a|--all] [-A|--autobackup y|n] [-d|--debug] [-h|--help] [--mirrorsonly] [--removemissing] [-f|--force] [-t|--test] [-v|--verbose] [--version] VolumeGroupName [PhysicalVolumePath...] Remove physical volume(s) from a volume groupvgremove [-d|--debug] [-f|--force] [-h|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] VolumeGroupName [VolumeGroupName...] vgrename [-A|--autobackup y|n] [-d|--debug] [-h|--help] [-t|--test] [-v|--verbose] [--version] OldVolumeGroupPath NewVolumeGroupPath | OldVolumeGroupName NewVolumeGroupName vgs [--aligned] [-a|--all] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--nameprefixes] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-P|--partial] [--rows] [--separator Separator] [--trustcache] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [--unquoted] [-v|--verbose] [--version] [VolumeGroupName [VolumeGroupName...]] Display information about volume groupsvgscan [-d|--debug] [-h|--help] [--ignorelockingfailure] [--mknodes] [-P|--partial] [-v|--verbose] [--version] vgsplit [-A|--autobackup {y|n}] [--alloc AllocationPolicy] [-c|--clustered {y|n}] [-d|--debug] [-h|--help] [-l|--maxlogicalvolumes MaxLogicalVolumes] [-M|--metadatatype 1|2] [-n|--name LogicalVolumeName] [-p|--maxphysicalvolumes MaxPhysicalVolumes] [-t|--test] [-v|--verbose] [--version] SourceVolumeGroupName DestinationVolumeGroupName [PhysicalVolumePath...] Move physical volumes into a new or existing volume groupDisplay software and driver version informationSize is not a multiple of 512. Try using %llu or %llu.Major number outside range 0-255Minor number outside range 0-255Option%s%c%s%s may not be repeatedError during parsing of command line.Updated config file invalid. Aborting.Partial mode. Incomplete volume groups will be activated read-only.--trustcache is incompatible with --allWARNING: Cache file of PVs will be trusted. New devices holding PVs may get ignored.Locking type %d initialisation failed.Test mode: Wiping internal cacheRun `%s --help' for more information.getrlimit(RLIMIT_NOFILE) failed: %s File descriptor %d (%s) leaked on %s invocation.Close failed on stray file descriptor %d (%s): %sFalling back to LVM1 tools, but no command specified.Failed to create LVM1 tool pathnameLine too long (max 255) beginning: %sInternal error: Failed command did not use log_errorCommand failed with status code %d.;D%-*s [%15s] %slvmdiskscan.cdev_iter_create failedCouldn't get size of "%s"LVM physical volumedev_close on "%s" failed%d disk%s%d partition%s%d LVM physical volume%sWARNING: only considering LVM devices%d LVM physical volume whole disk%sPlease enter one or more logical volume pathslvremove.cOld and new logical volume names requiredLogical volume names must have the same volume group ("%s" or "%s")New logical volume path exceeds maximum length of %zu!New logical volume name may not be blankNew logical volume name "%s" is invalidOld and new logical volume names must differExisting logical volume "%s" not found in volume group "%s"Renamed "%s" to "%s" in volume group "%s"lvrename.cfsadm--dry-runchecklvresize.c%lluKFinding volume group %sCan't resize locked LV %sNew size of 0 not permittedExtending %u mirror images.lv_info failed: aborting and openLogical volume %s NOT reducedReducExtend%sing logical volume %s to %sFailed to suspend %sCouldn't create LV path for %sCouldn't generate new LV size stringPlease specify either size or extents but not both.Negative argument not permitted - use lvreducePositive sign not permitted - use lvextendPlease provide the logical volume nameLogical volume %s not found in volume group %sVaried striping not supported. Ignoring.Mirrors not supported. Ignoring.Stripesize may not be negative.Varied stripesize not supported. Ignoring.Reducing stripe size %s to maximum, physical extent size %sMirrors and striping cannot be combined yet.Stripe size must be power of 2Can't resize %s while lvconvert in progressRounding up size to full physical extent %sUnable to reduce %s below 1 extentNew size (%d extents) matches existing size (%d extents)VolumeType does not match (%s)Please specify number of stripes (-i) and stripesize (-I)Using stripesize of last segment %sCannot vary number of mirrors in LV yet.Ignoring stripes, stripesize and mirrors arguments when reducingStripesize for striped segment should not be 0!Rounding size (%d extents) down to stripe boundary size for segment (%d extents)New size given (%d extents) not larger than existing size (%d extents)New size given (%d extents) not less than existing size (%d extents)Snapshot origin volumes cannot be reduced in size yet.Snapshot origin volumes can be resized only while inactive: try lvchange -anIgnoring PVs on command line when reducingLogical volume %s must be activated before resizing filesystemWARNING: Reducing active%s logical volume to %sTHIS MAY DESTROY YOUR DATA (filesystem etc.)Do you really want to reduce %s? [y/n]: Logical volume %s successfully resizedNo additional command line arguments allowedlvscan.cACTIVE inactive OriginalSnapshot%s%s '%s%s/%s' [%s] %sFailed to generate list of copied LVs: can't abort.ABORTING: Failed to generate list of copied LVsABORTING: Segment progression failed.Checking progress every %u secondsBackground process failed to setsid: %sABORTING: Can't reread VG for %sABORTING: Can't find mirror LV in %s for %sABORTING: Mirror percentage check failed.polldaemon.cForking background processfork failed: %s(lvm2copyd)%s: %s: %.1f%%pvchange.c#orphansCan't get lock for orphansUnable to read PV "%s"Changing uuid of %s to %s.Updating physical volume "%s"Physical volume "%s" changedFinding volume group %s of physical volume %sUnable to find "%s" in volume group "%s"Volume group containing %s does not support tagsVolume group containing %s has active logical volumesCan't change tag on Physical Volume %s not in volume groupAllocatability not supported by orphan %s format PV %sPhysical volume "%s" is already allocatablePhysical volume "%s" is already unallocatableFailed to add tag %s to physical volume %sFailed to remove tag %s from physical volume%sFailed to generate new random UUID for %s.pv_write with new uuid failed for %s.Failed to store physical volume "%s" in volume group "%s"Failed to store physical volume "%s"Setting physical volume "%s" allocatableSetting physical volume "%s" NOT allocatablePlease give exactly one option of -x, -uuid, --addtag or --deltagPlease give a physical volume pathOption a and PhysicalVolumePath are exclusiveUsing physical volume(s) on command lineFailed to read physical volume %sRescan for PVs without metadata areas failed.Scanning for physical volume names%d physical volume%s changed / %d physical volume%s not changedScanning %spvck.c--uuid is required with --restorefileCan only set uuid on one volume at onceUnable to read volume group from %sCan't find uuid %s in backup file %sPhysical volume size may not be negativepvcreate.cCan't get lock for orphan PVspvdisplay.cSkipping volume group %sOption -v not allowed with option -cDevice "%s" has a capacity of %sPhysical volume "%s" of volume group "%s" is exported"%s" is a new physical volume of "%s"pvmove.cABORTING: Can't reread PV %sRemoving temporary pvmove LVMovedFailed to clone PV namepvmove%dSkipping mirror LV %sSkipping mirror log LV %sSkipping mirror image LV %sSkipping locked LV %sLogical volume %s not found.No data to move for %sABORTING: Removal of temporary mirror failedABORTING: Failed to write new data locations to disk.Locking LVs to remove temporary mirror failedSuspension of temporary mirror LV failedUnable to reactivate logical volume "%s"ABORTING: Unable to deactivate temporary logical volume "%s"ABORTING: Removal of temporary pvmove LV failedWriting out final volume group after pvmoveUpdating volume group metadataABORTING: Volume group metadata update failed.Temporary pvmove mirror activation failed.ABORTING: Restoring original configuration before pvmove failed. Run pvmove --abort.Unable to resume logical volumes--name takes a logical volume nameNamed LV and old PV must be in the same VGIncomplete LV name supplied with --nameLogical volume name %s is invalidDetected pvmove in progress for %sIgnoring remaining command line argumentsABORTING: Failed to generate list of moving LVsABORTING: Temporary mirror activation failed.No extents available for allocationCreation of temporary pvmove LV failedlvs_changed list struct allocation failedSkipping snapshot-related LV %sMoving %u extents of logical volume %s/%sAll data on source PV skipped. It contains locked, hidden or non-top level LVs only.Failed to convert pvmove LV to mirroredFailed to split segments being movedPlease enter a physical volume pathOption y can only be given with option fCan't pvremove physical volume "%s" of volume group "%s" without -ff%s: physical volume label not removedWARNING: Wiping physical volume label from %s%s%s%s%s: Couldn't find device. Check your filters?Can't open %s exclusively - not removing. Mounted filesystem?Failed to wipe existing label(s) on %sLabels on physical volume "%s" successfully wipedpvremove.cPhysical Volume %s not found of volume group "Really WIPE LABELS from physical volume "%s" of volume group "%s" [y/n]? Please supply physical volume(s)%d physical volume(s) resized / %d physical volume(s) not resizedUnable to read volume group "%s".Can't get info for PV %s in volume group %s%s: too many metadata areas for pvresizePhysical volume %s format does not support resizing.WARNING: %s: Overriding real size. You could lose data.%s: Pretending size is %llu not %llu sectors.%s: Size must exceed minimum of %ld sectors.%s: Size must exceed physical extent start of %llu sectors.%s: Size must leave space for at least one physical extent of %u sectors.Resizing volume "%s" to %llu sectors.pvresize.c%s: Couldn't get size.Options -e and -n are incompatibleWARNING: only considering physical volumes %sWalking through all physical volumesPV %-*s is in exported VG %s [%s / %s free]PV %-*s VG %-*s %s [%s / %s free]No matching physical volumes foundTotal: %d [%s] / in use: %d [%s] / in no VG: %d [%s]pvscan.cof exported volume group(s)in no volume group#globalUnable to obtain global lock.%-*s with UUID %sPV %-*s %-*s %s [%s]report/alignedreport/bufferedreport/headingsreport/separatorreport/prefixesreport/quotedreport/columns_as_rowsvg_name,lv_namereport/lvs_sortreport/lvs_colsreport/lvs_cols_verbosevg_namereport/vgs_sortreport/vgs_colsreport/vgs_cols_verbosepv_namereport/pvs_sortreport/pvs_colsreport/pvs_cols_verbosevg_name,lv_name,seg_startreport/segs_sortreport/segs_colsreport/segs_cols_verbosepv_name,pvseg_startreport/pvsegs_sortreport/pvsegs_colsreport/pvsegs_cols_verboseInvalid options string: %sreporter.clv_name,vg_name,lv_attr,lv_size,origin,snap_percent,move_pv,mirror_log,copy_percent,convert_lvlv_name,vg_name,seg_count,lv_attr,lv_size,lv_major,lv_minor,lv_kernel_major,lv_kernel_minor,origin,snap_percent,move_pv,copy_percent,mirror_log,convert_lv,lv_uuidvg_name,pv_count,lv_count,snap_count,vg_attr,vg_size,vg_freevg_name,vg_attr,vg_extent_size,pv_count,lv_count,snap_count,vg_size,vg_free,vg_uuidpv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_freepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,dev_size,pv_uuidlv_name,vg_name,lv_attr,stripes,segtype,seg_sizelv_name,vg_name,lv_attr,seg_start,seg_size,stripes,segtype,stripesize,chunksizepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_sizepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_size,lv_name,seg_start_pe,segtype,seg_pe_rangesoptions string allocation failedCan't report LV and PV fields at the same time9 9f9999999999999999999999999nSnxnnnnnnnnnn0nnnnnnnnnnnnnnnlabelsector must be less than %luMetadata and data alignment parameters only apply to text format.Metadatacopies may only be 0, 1 or 2Physical volume data alignment may not be negativePhysical volume data alignment is too big.WARNING: Ignoring data alignment %llu incompatible with --restorefile value (%llu).Physical volume data alignment offset may not be negativePhysical volume data alignment offset is too big.WARNING: Ignoring data alignment offset %llu incompatible with --restorefile value (%llu).Metadata size may not be negativeSpawning background pvmove process for %sSpawning background lvconvert process for %sNames starting "snapshot" are reserved. Please choose a different LV name.Names starting "pvmove" are reserved. Please choose a different LV name.Names including "_mlog" are reserved. Please choose a different LV name.Names including "_mimage" are reserved. Please choose a different LV name.Names including "_vorigin" are reserved. Please choose a different LV name.Unable to allocate physical volume list.Adding PE range: start PE %u length %u on %sOverlapping PE ranges specified (%u-%u, %u-%u) on %sPhysical volume %s not allocatableNo free extents on physical volume "%s"Allocation of pe_ranges list failedPE range error: start extent %u to end extent %uPhysical extent parsing error at %sPhysical Volume "%s" not found in Volume Group "%s"No specified PVs have space availableFailed to read physical volume "%s"Using all physical volume(s) in volume groupUnable to find %s in volume group %sOne or more specified logical volume(s) not found.skip_dev_dir: Couldn't split up device name %sPhysical extent size may not be negativeMax Logical Volumes may not be negativeMax Physical Volumes may not be negativeEnvironment Volume Group in LVM_VG_NAME invalid: "%s""%s": Invalid path for Logical VolumePath required for Logical Volume "%s"Using volume group(s) on command lineUsing logical volume(s) on command linetoollib.cmetadata/pvmetadatasizemetadata/pvmetadatacopies_mlog_mimageAllocation of list failedPhysical volume %s is missingSkipping invalid tag %sstrlist allocation faileddev_iter creation failedvg/lv string alloc failedLVM_VG_NAMEAllocation of vg_name failedInvalid volume group name: %sFinding all volume groupsNo volume groups foundFinding all logical volumesvgcfgbackup.cFailed to allocate filename.Error processing filename template %sVGs must be backed up into different files. Use %%s in filename for VG name.No backup taken: specify filename with -f to backup an inconsistent VGVolume group "%s" successfully backed up.Volume group name "%s" is invalidPlease specify a *single* volume group to restore.Unable to lock volume group %svgcfgrestore.cUnable to lock orphansRestore failed.Restored volume group %sOne of -a, -c, -l, -p, -s, -x, --refresh, --uuid, --alloc, --addtag or --deltag requiredOnly one of -a, -c, -l, -p, -s, -x, --uuid, --alloc, --addtag or --deltag allowed--ignorelockingfailure only available with -a-A option not necessary with -a optionVolume group %s does not support tagsFailed to add tag %s to volume group %sFailed to remove tag %s from volume group %sVolume group "%s" successfully changedCan't deactivate volume group "%s" with %d open logical volume(s)%d logical volume(s) in volume group "%s" already active%d existing logical volume(s) in volume group "%s" %smonitored%s %d logical volumes in volume group %s%d logical volume(s) in volume group "%s" now active%d logical volume(s) in volume group "%s" %smonitoredVolume group "%s" is already resizeableVolume group "%s" is already not resizeableMaxPhysicalVolumes may not be negativePhysical extent size of VG %s is already %sVolume group has active logical volumesFailed to generate new random UUID for VG %s.Volume group allocation policy is already %sVolume group "%s" is already clusteredVolume group "%s" is already not clusteredvgchange.cVolume group "%s" is exportedDeactivatedActivatedRefreshing volume group "%s"vgck.cPlease provide volume group name and physical volumesInvalid option --metadatacopies, use --pvmetadatacopies instead.A volume group called %s already exists.WARNING: Setting maxlogicalvolumes to %d (0 means unlimited)WARNING: Setting maxphysicalvolumes to %d (0 means unlimited)Volume group format does not support tags%s%colume group "%s" successfully createdvgcreate.cCan't get lock for %s.Clustered Non-clustered Please enter volume group(s)vgconvert.cMetadata parameters only apply to text formatVolume group "%s" already uses format %sArchive of "%s" metadata failed.Logical volume %s lvid format is incompatible with requested metadata format.Logical volume %s must be deactivated before conversion.Failed to setup physical volume "%s"Use pvcreate and vgcfgrestore to repair from archived metadata.Set up physical volume for "%s" with %llu available sectorsFailed to wipe existing label on %sWriting physical volume data to disk "%s"Failed to write physical volume "%s"Physical volume "%s" successfully createdDeleting existing metadata for VG %sRemoval of existing metadata for %s failed.Test mode: Skipping metadata writing for VG %s in format %sWriting metadata for VG %s using format %sConversion failed for volume group %s.Volume group %s successfully convertedvgdisplay.c--- Physical volumes ---Option -c is not allowed with option -sOption -A is not allowed with volume group namesPlease supply volume groups or use -a for all.No arguments permitted when using -a for all.Volume group "%s" has active logical volumesVolume group "%s" successfully exportedvgexport.cPlease enter volume group name and physical volume(s)Checking for volume group "%s"Volume group "%s" will be extended by %d new physical volumesVolume group "%s" successfully extendedvgextend.cVolume group "%s" is not exportedVolume group "%s" is partially missingVolume group "%s" successfully importedvgimport.cPlease enter 2 or more volume groups to mergeDuplicate volume group name "%s"Failed to generate new random LVID for %sWriting out updated volume groupVolume group "%s" successfully merged into "%s"vgmerge.cChanged LVID for %s to %svgmknodes.cVolume Groups must always contain at least one PVRemoving PV with UUID %s from VG %sLVs still present on PV with UUID %s: Can't remove from VG %s%s/%s has missing extents: removing (including dependencies)Deactivating (if active) logical volume %s (origin of %s)Please give volume group name and physical volume paths--mirrorsonly requires --removemissingPlease enter physical volume paths or option -aOption -a and physical volume paths mutually exclusivePlease only specify the volume groupVolume group "%s" is already consistentTrying to open VG %s for recovery...Non-mirror-image LV %s found: can't remove.Aborting because --mirrorsonly was specified.Failed to write out a consistent VG for %sFailed to commit consistent VG for %sFailed to resume LVs using error segments.The log device for %s/%s has failed.Log device for %s/%s has failed.Failed to write out updated VG for %sFailed to commit updated VG for %sDeactivating (if active) logical volume %sWARNING: Partial LV %s needs to be repaired or removed. WARNING: There are still partial LVs in VG %s.To remove them unconditionally use: vgreduce --removemissing --force.Proceeding to remove empty missing PVs.Wrote out consistent volume group %sPhysical volume "%s" still in useCan't remove final physical volume "%s" from volume group "%s"Removing "%s" from volume group "%s"Cannot remove final metadata area on "%s" from "%s"Removal of physical volume "%s" from "%s" failedFailed to clear metadata from physical volume "%s" after removal from "%s"Removed "%s" from volume group "%s"vgreduce.cFailed to deactivate LV %sRemoving LV %s from VG %slv_list alloc failedPlease give volume group namePlease enter one or more volume group pathsWARNING: %d physical volumes are currently missing from the system.Do you really want to remove volume group "%s" containing %u logical volumes? [y/n]: vgremove.cVolume group "%s" not removedChecking for new volume group "%s"New volume group "%s" already existsVolume group "%s" still has active LVsOld and new volume group names need specifyingNo complete volume groups foundFound more than one VG called %s. Please supply VG uuid.Volume group "%s" successfully renamed to "%s"vgrename.cCan't get lock for %sRenaming "%s" to "%s"Test mode: Skipping rename.Renaming "%s" to "%s" failedToo many parameters on command lineReading all physical volumes. This may take a while...Found %svolume group "%s" using metadata type %svgscan.cexported Logical volume "%s" must be inactiveExisting VG, new VG and either physical volumes or logical volume required.A logical volume name cannot be given with physical volumes.Unable to set new VG metadata type based on source VG format - use -M option.Volume group "%s" exists, but new VG option specifiedCan't split Logical Volume %s between two Volume GroupsCan't split mirror %s between two Volume GroupsCan't split snapshot %s between two Volume GroupsCannot split: Nowhere to store metadata for new Volume GroupWriting out updated volume groupsVolume group "%s" became inconsistent: please fix manually%s volume group "%s" successfully split from "%s"vgsplit.cExistingNewHOME%s/.lvm_historylvm.cshell/history_sizelvm> Too many arguments, sorry.Exiting.Couldn't write history to %s.-%c$HOME/.lvm_history: path too longCouldn't read history from %s.No such command '%s'. Try 'help'.Activation enabled. Device-mapper kernel driver will be used.WARNING: Activation disabled. No device-mapper interaction will be attempted.Ignoring invalid string in config file activation/volume_listIgnoring empty string in config file activation/volume_listIgnoring empty tag in config file activation/volume_listNot activating %s/%s due to config file settings%s/%s: %s segment monitoring function failed.%s/%s %smonitoring still pending: waiting...Refusing activation of partial LV %s. Use --partial to override.Refusing activation of LV %s containing an unrecognised segment.LV %s/%s in use: not deactivatingLV %s/%s has open snapshot %s: not deactivatingmodule_present module name too long: %sFailed to get %s target versionmodule string allocation failedsnap_seg module string allocation failedLVM1 proc global snprintf failedactivate/activate.cGetting device info for %sactivation/volume_listdm_snprintf error from %s/%sFailed to %smonitor %s%s/%s already monitored.%s/%s already not monitored.%sonitoring %s/%sMNot mSkipping: Activating '%s'.Skipping: Deactivating '%s'.Skipping: Resuming '%s'.Skipping: Suspending '%s'.dm-%s/sbin/modprobeGetting target version for %sGetting driver version%s/lvm/globalWiping internal VG cachecache/lvmcache.cMetadata cache: VG %s wiped.lvmcache: %s: clearing VGID with %u mdaslvmcache: initialised VG %snowno longer, precommittedpvids list allocation failedpre-committed#orphans_lvm2#orphans_lvm1#orphans_poolrefresh filters failedvgids list allocation failedCache locking failure for %sInternal error: Volume Group %s was not unlockedInternal error: _vginfos list should be emptyInternal error: VG lock %s must be requested before %s, not after._lvmcache_update: vgid hash insertion failed: %slvmcache: %s: setting %s VGID to %s_vgname_hash re-insertion for %s failedlvmcache_update_vgname: list alloc failedcache vgname alloc failed for %slvmcache: %s: now in VG %s%s%s%s%sWARNING: Duplicate VG name %s: Existing %s takes precedence over exported %sWARNING: Duplicate VG name %s: %s takes precedence over exported %sWARNING: Duplicate VG name %s: Existing %s (created here) takes precedence over %sWARNING: Duplicate VG name %s: %s (with creation_host) takes precedence over %sWARNING: Duplicate VG name %s: %s (created here) takes precedence over %scache_update: vg hash insertion failed: %sInternal error: NULL vgname handed to cachelvmcache: %s: VG %s %s exportedcache creation host alloc failed for %slvmcache: %s: VG %s: Set creation host to %s.Metadata cache: VG %s (%s) stored (%d bytes%s).Precommitted metadata cache: VG %s upgraded to committed.Internal error: metadata commit (or revert) missing before dropping metadata from cache.Using cached %smetadata for VG %s.device_list element allocation failedInternal error: Attempt to unlock unlocked VG %s.Internal cache initialisation failedvgnames list allocation failedInternal error: Nested locking attempted on VG %s.lvmcache_info allocation failedIgnoring duplicate PV %s on %s - using %s %sIgnoring duplicate PV %s on %s - using dm %sDuplicate PV %s on %s - using %s %sDuplicate PV %s on %s - using dm %sFound duplicate PV %s: using %s not %sUpdating pvid cache to %s (%s) from %s (%s)_lvmcache_update: pvid insertion failed: %slog/sysloglog/levellog/verboselog/indentlog/prefixlog/command_namesglobal/testlog/overwritelog/filelog/activate_filelog/activationLogging initialised at %scommands/toolcontext.cSetting host tag: %stags/hosttagshost_listhost_filterhost_filter not supported yet%s/lvm%s%s.confconfig_tree allocation failedLoading config file: %sFailed to load config file %sFailed to create config treeglobal/umaskSet umask to %04odevices/dir%s/global/proc%s/mounts_get_sysfs_dir: fopen %ssysfsglobal/activationglobal/suffixglobal/unitsactivation/readaheadactivation/udev_sync/dev/ioerror stat failed: %sglobal/si_unit_consistencydevices/scandevices/loopfilesdevices/sysfs_scandevices/filterdevices/typesdevices/cache_dirdevices/cache_file_prefix%s%s%s/%s.cachedevices/cache%s/%s/%s.cachedevices/write_cache_stateinit_segtypeglobal/format_librariesinit_formatglobal/formatglobal/segment_librariessegment typeinit_multiple_segtypesReloading config filessetlocale failedLVM_SYSTEM_DIRuname_init_hostnamecommandbackup/archivebackup/retain_daysbackup/retain_minbackup/archive_dirarchive_init failed.backup/backupbackup/backup_dirbackup_init failed.Duplicate segment type %s: unloading shared library %s_set_tag: str_list_add %s failedInvalid tag in config file: %sInvalid hostname string for tag %sLVM_SYSTEM_DIR or tag was too longconfig_tree_list allocation failedDevice directory given in config file too longWARNING: proc dir %s not found - some checks will be bypassedNo proc filesystem found: skipping sysfs detectionFailed to create /proc/mounts string for sysfs detectionFailed to find sysfs mount pointInvalid readahead specificationactivation/missing_stripe_fillerWARNING: activation/missing_stripe_filler = "%s" is invalid,Falling back to "error" missing_stripe_filler.WARNING: activation/missing_stripe_filler = "%s" is not a block device.Failed to add /dev to internal device cachedevice/scan not in config file: Defaulting to /devInvalid string in config file: devices/scanFailed to add %s to internal device cacheInvalid string in config file: devices/loopfilesFailed to add loopfile %s to internal device cachedevices/filter not found in config file: no regex filter installedFailed to create regex device filterFailed to create lvm type filterdevices/md_component_detectiondevices/ignore_suspended_devicesPersistent cache filename too long.Failed to create persistent device filterFailed to load existing device cache from %sShared library %s does not contain segment type functionsInvalid string in config file: global/format_librariesShared library %s does not contain format functions_init_formats: Default format (%s) not foundInvalid string in config file: global/segment_librariesWARNING: Shared lib %s has conflicting init fns. Using init_multiple_segtypes().init_multiple_segtypes() failed: Unloading shared library %sFailed to allocate command contextLVM_SYSTEM_DIR environment variable is too long.Failed to create LVM2 system dir for metadata backups, config files and internal cache.Set environment variable LVM_SYSTEM_DIR to alternative location or empty string.Library memory pool creation failed_init_hostname: dm_pool_strdup failed_init_hostname: dm_pool_strdup kernel_vsn failedCommand memory pool creation failedCouldn't create default archive path '%s/%s'.Couldn't create default backup path '%s/%s'.(root)config/config.cSetting %s to %fSetting %s to %lldSetting %s to %s[]%s}=stdoutconfig_lineDumping configuration to %sFailure while writing to %smmap%s: Checksum errormunmap%s is not a regular file%s is emptyofffalsetrueWARNING: Ignoring duplicate config node: %s (seeking %s)%s not found in config: defaulting to %f%s not found in config: defaulting to %lld%s not found in config: defaulting to %sdm_pool_begin_object failed for config linevsnprintf failed for config linedm_pool_grow_object failed for config line_write_value: Unknown value type: %dConfiguration node %s not foundConfig file %s has disappeared!Failed to reload configuration filesConfiguration file %s is not a regular fileDetected config file change to %sParse error at byte %td (line %d): unexpected tokenParse error at byte %td (line %d): expected a valueFailed to allocate config pool.Failed to allocate config tree.Failed to allocate config tree parser.Failed to set overridden configuration entries.I/////// ///////////////////////////////// //////////////////////////////)/9str_list allocation faileddatastruct/str_list.cunknown devicedevice/dev-cache.c%s: New preferred namedev_cachedevices/preferred_namespreferred device name matcherfilename strdup failed%s: Already in device cachelstat%s: Added to device cache (preferred name)%s: Not a block device%s: Not a regular filedev_iter allocation failedIgnoring %s: %sIgnoring %s: Not a directorydir_list allocation failedDevice '%s' has been left open.Couldn't create binary tree for dev-cache.devices/preferred_names not found in config file: using built-in preferencespreferred_names patterns must be enclosed in quotesFailed to allocate preferred device name pattern list.Failed to allocate a preferred device name pattern.Preferred device name pattern matcher creation failed.struct device allocation failedstruct str_list allocation failedCouldn't insert device into binary tree.%s: Aliased to %s in device cache%sCouldn't add alias to dev cache.Couldn't add name to hash in dev cache.%s: Symbolic link to directoryIgnoring %s: Not a regular filedir_list allocation failed for filePath %s no longer valid for device(%d,%d)Aborting - please provide new pathname for what used to be %sAttempt to read an unopened device (%s).%s: %s failed after %llu of %llu at %llu: %sAttempt to close device '%s' which is not open.%s: Immediate close attempt while still referencedWARNING: %s already opened read-onlyWARNING: dev_open(%s) called while suspended%s: fstat failed: Has device name changed?Wiping %s at sector %llu length %zu sectorsdevice/dev-io.cRead size too large: %llu%s: lseek %llu failed: %sClosed %s%s: size is %llu sectorsioctl BLKGETSIZE64%s: stat failed%s: device changed%s: Not using O_DIRECT O_EXCLRWROOpened %s %s%s%sioctl BLKRAGET%s: read_ahead is %u sectorsioctl BLKBSZGET%s: block size is %u bytesWiping %s at %llu length %zuRead from %s failedCircular read from %s faileddisplay/display.c--- Segments ---Logical extent %u to %u: Type %s--- Physical Segments ---Physical extent %u to %u: Logical volume %s%s/%s Logical extents %d to %d FREEr/wMissing%sPhysical volume %s%sPhysical extents %d to %d%sLogical volume %s%sLogical extents %d to %d%sUnassigned areaPV Name %s PV UUID %sNOT Total PE / Free PE %u / %u0%s%.*f%s--- Volume group ---VG Name %sSystem ID %sFormat %sMetadata Areas %dMetadata Sequence No %dread/writeexported/Clustered yesShared %sMAX LV %uCur LV %uOpen LV %uMax PV %uCur PV %uAct PV %uVG Size %sPE Size %sTotal PE %uAlloc PE / Size %u / %sFree PE / Size %u / %sVG UUID %s--- Logical volume ---VG Name %sLV UUID %sread onlyLV Write Access %sactiveINACTIVE# open %uLV Size %sCurrent LE %uCOW-table size %sCOW-table LE %uSnapshot chunk size %sMirrored volumes %uSegments %uAllocation %sRead ahead sectors autoRead ahead sectors 0Read ahead sectors %u- currently set to %uPersistent major %dPersistent minor %dBlock device %d:%dNEW --- %sPhysical volume ---PV Name %s (exported)VG Name %s%sPV Size %s(but full)Allocatable yes %sAllocatable NOPE Size (KByte) %uFree PE %uAllocated PE %unext free Exabyte EB Petabyte PB Terabyte TB Gigabyte GB Megabyte MB Kilobyte Exbibyte EiB Pebibyte PiB Tebibyte TiB Gibibyte GiB Mebibyte MiB Kibibyte KiB kB Byte B Units UnU Sectors Se%s:%s:%d:-1:%u:%u:%u:-1:%u:%u:%u:%llu:%u:%u:%u:%u:%sPV Status %sallocatable%s:%s:%llu:-1:%u:%u:-1:%u:%u:%u:%u:%s%s%s/%s:%s:%d:%d:-1:%d:%llu:%d:-1:%d:%d:%d:%dno memory for size display buffer"%s" %-9s [%-9s used / %s free]VG Access %s%s%s%sVG Status %s%sresizableLV Name %s%s/%sLV snapshot status source of %s%s/%s [%s]LV snapshot status %s destination for %s%s/%sLV Status suspendedLV Status %savailableAllocated to snapshot %.2f%% LV type Mirror undergoing conversionPV Size %s / not usable %sUnrecognised allocation policy %s_\\\,\\\\\w\\X\\\\\\\\\\\\\\\I\=,\\ \\\\\contiguousclingnormalanywhereinheriterror/errseg.cInitialised segtype: %serroerror module string list allocation failedfilters/filter-composite.cUsing %scomposite filters allocation failedcompsoite filters allocation failedfilters/filter-persistent.c%s: Skipping (cached)%s: stat failed: %sfstat%s.tmpfopenpersistent_filter_cache { , valid_devices %s=[ "%s" ] } %s: rename to %s failed: %sCouldn't create hash table for persistent filter.Wiping cache of LVM-capable devicespersistent_filter_cache/valid_devicesCouldn't find %s array in '%s'Devices array contains a value which is not a string ... ignoringCouldn't add '%s' to filter ... ignoringLoaded persistent filter cache from %sInternal persistent device cache empty - not writing to %sDevice cache incomplete - not writing to %sDumping persistent device cache to %s# This file is automatically maintained by lvm. filter regexfilters/filter-regex.cfilter dm_regexinvalid filter pattern%s: Skipping (regex)filter patterns must be enclosed in quotespattern must begin with 'a' or 'r'invalid separator at end of regexNo proc filesystem found: skipping sysfs filtersysfs path name too long: %s in %ssysfs device file not correct formatfilters/filter-sysfs.csubsystem/block/devicesclass/blocksysfs pool creation failedsysfs dev_set creation failedopendir..Empty sysfs device file: %s%u:%uclosedir%s: Skipping (sysfs)filters/filter-md.cmd filter allocation failed%s: Skipping md component device%s: Skipping: error in md component detectionDRBDfilters/filter.c%s/devicesmdblkextdrbddevice-mapper%s: Skipping: open failedidemdploopdasddac960idaccissubdataraidemcpowerpower2i2o_blockiseries/vdgnbdramdiskaoexvdvdiskps3diskvirtblkmmcLVM type filter allocation failedNo proc filesystem found: using all block device typesFailed to create /proc/devices stringExpecting string in devices/types in config fileMax partition count missing for %s in devices/types in config fileZero partition count invalid for %s in devices/types in config file%s: Skipping: Unrecognised LVM device type %llu%s: Skipping: Suspended dm device%s: Skipping: dev_get_size failed%s: Skipping: Too small to hold a PV%s: Skipping: Partition table signature foundCreating volume group backup "%s" (seqno %u).Couldn't create backup object.Couldn't create text format object.Failed to allocate format instancePV %s is a different format (seqno %s)Format-specific setup for %s failedCannot restore Volume Group %s with %i PVs marked as missing.Failed to generate backup filename (for restore).Failed to generate backup filename (for removal).WARNING: This metadata update is NOT backed upTest mode: Skipping volume group backup.Failed to generate volume group metadata backup filename.Backup of volume group %s metadata failed.Couldn't copy backup directory name.Couldn't copy archive directory name.Test mode: Skipping archiving of volume group.Archiving volume group "%s" metadata (seqno %u).Volume group "%s" metadata archive failed.Failed to generate backup filename.format_text/archiver.cPV %s missing from cache*before**after*Created %s executing '%s'backup_params alloc failedarchive_params alloc failedInternal error tracking indentation# Generated by LVM2 version %s: %scontents = "Text Format Volume Group"creation_host = "%s" # %s %s %s %s %stext_export buffer allocation failedDoubling metadata output buffer to %uformat_text/export.cuname failed: %s%ss = [,"%s", %u%sstatus = %sflags = %s# Hint onlyKilobytes# %g %s%s {tags = %sallocation_policy = "%s"read_ahead = -1# Noneread_ahead = %umajor = %dminor = %dsegment_count = %usegment%u {start_extent = %uextent_count = %utype = "%s"physical_volumes {device = "%s"dev_size = %llupe_start = %llupe_count = %uversion = %ddescription = "%s"creation_time = %lu # %stext pv_namespv%dseqno = %usystem_id = "%s"extent_size = %umax_lv = %umax_pv = %ulogical_volumes {Buffer reallocation failed.MegabytesGigabytesTerabytesPetabytesExabytes?:Unknown flag set requested.format_text/flags.cStatus value is not a string.PARTIALUnknown status flag '%s'.EXPORTEDRESIZEABLEPVMOVEREADWRITECLUSTEREDSHAREDALLOCATABLEMISSINGFIXED_MINORVISIBLELOCKEDNOTSYNCEDMetadata inconsistency: Not all flags successfully exported.Extent size must be power of 2struct mda_header allocation failedIncorrect metadata area header checksumWrong magic number in metadata area headerIncompatible metadata area header version: %dIncorrect start sector in metadata area header: %lluFound text metadata area: offset=%llu, size=%lluFound LVM2 metadata record at offset=%llu, size=%zu, offset2=%llu size2=%zuFailed to write metadata area header%sCommitting %s metadata (%u) to %s header at %lluWiping pre-committed %s metadata from %s header at %lluVG %s metadata too large for circular bufferWriting %s metadata to %s at %llu len %lluWriting metadata to %s at %llu len %lluRead %s %smetadata (%u) from %s at %llu size %lluTest mode: Skipping committing %s metadata (%u)Text format failed to determine directory.Couldn't create temporary text file name.Failed to write metadata to %s.'%s' does not contain volume group '%s'.Random lvid creation failed for %s/%s.Creating metadata area on %s at sector %llu size %llu sectors%s: setting pe_start=%llu (orig_pe_start=%llu, pe_align=%lu, pe_align_offset=%lu, adjustment=%llu)Data area is beyond end of device %s!Couldn't create text label handler.Couldn't register text label handler.Invalid string in config file: metadata/dirsAdding text format metadata dir: %sFailed to add %s to text format metadata directory list Empty metadata disk_area section of config fileMissing start_sector in metadata disk_area section of config fileMissing size in metadata disk_area section of config fileMissing uuid in metadata disk_area section of config fileInvalid uuid in metadata disk_area section of config file: %sCouldn't find device with uuid '%s'.%s: Volume group filename may not end in .tmpCouldn't allocate text format context object.Couldn't allocate format instance object.Couldn't allocate text_fid_context.%s: metadata too large for circular buffer%s: Found metadata at %llu size %llu (in area at %llu size %llu) for %s (%s)Must be exactly one data area (found %d) on PV %smetadata_area allocation failedPV %s too large for extent size %s.WARNING: %s: Overriding data alignment to %lu sectors (requested %lu sectors)WARNING: %s: Overriding data alignment offset to %lu sectors (requested %lu sectors)%s: pe_align (%lu sectors) must not be less than pe_align_offset (%lu sectors)Physical extents end beyond end of device %s!WARNING: metadata area fills disk leaving no space for data on %s.Insufficient space for first mda on %sFailed to wipe new metadata areaformat_text/format-text.c LVM2 x[5A%r0N*>Pre-VG %s metadata writing failedVG %s not found on %spre-commit unlinkUnlinking %sCommitting %s metadata (%u)Renaming %s to %sTest mode: Skipping renamefdopenWriting %s metadata to %sfsyncRead volume group %s from %stextFailed to allocate dir_listmetadata/dirs_add_dir allocation failedmetadata/disk_areasstart_sectorCouldn't find device._add_raw allocation failedInitialised format: %sName too long %s/%sdevices/data_alignmentformat_text/import.cCouldn't read volume group metadata.Can't process text format file - %s.Couldn't find volume group in file.Couldn't read uuid for volume group %s.Couldn't find status flags for volume group %s.Couldn't read 'seqno' for volume group %s.Error reading flags of volume group %s.Couldn't read extent size for volume group %s.Couldn't read 'max_lv' for volume group %s.Couldn't read 'max_pv' for volume group %s.allocation_policy must be a string.Couldn't find all physical volumes for volume group %s.Couldn't read tags for volume group %s.Couldn't read all logical volume names for volume group %s.Couldn't read all logical volumes for volume group %s.Failed to fixup mirror pointers after import for volume group %s.Lost logical volume reference %sCouldn't read uuid for logical volume %s.Couldn't read 'start_extent' for segment '%s' of logical volume %s.Couldn't read 'extent_count' for segment '%s' of logical volume %s.Segment type must be a string.Couldn't read tags for a segment of %s/%s.Only one segment permitted for snapshotCouldn't read segment count for logical volume %s.segment_count and actual number of segments disagree for logical volume %s.Couldn't read minor number for logical volume %s.Couldn't read major number for logical volume %s.Couldn't read status flags for logical volume %s.Couldn't read tags for logical volume %s/%s.Zero areas not allowed for segment %sBad volume name in areas array for segment %s.Missing offset in areas array for segment %s.Bad offset in areas array for segment %s.Couldn't find volume '%s' for segment '%s'.Incorrect number of areas in area array for segment '%s'.Couldn't read uuid for physical volume.Couldn't read status flags for physical volume.Couldn't read extent size for physical volume.Couldn't find extent count (pe_count) for physical volume.Couldn't read tags for physical volume %s in %s.Fixing up missing size (%s) for PV %sWARNING: Physical Volume %s is too large for underlying deviceformat_text/import_vsn1.cCouldn't find section '%s'.Couldn't find uuid.uuid must be a string.Invalid uuid.statusCould not find status flags.Could not read status flags.flagsCould not read flags.creation_hostdescriptioncreation_timelvm2 vg_readsystem_idsystem_id must be a stringseqnoextent_sizemax_lvmax_pvallocation_policyCouldn't create hash table.physical_volumeslogical_volumesEmpty logical volume section.Empty segment section.start_extentextent_countSegment allocation failed_mimagetmpsegment_countread_aheadcontentsmissing contents fieldText Format Volume Groupunrecognised contents fieldmissing version numberunrecognised version numberNULLEmpty pv section.dev_sizepe_startFound a tag that is not a stringformat_text/tags.cLVM2 001format_text/text_label.c mda2 (s, mda1 ( da1 (Couldn't allocate labeller object.struct mda_list allocation failedstruct mda_context allocation failedstruct data_area_list allocation failed%s: Preparing PV label header %s size %llu with%s%.*llu%s%.*llu%s%s%.*llu%s%.*llu%s%s%.*llu%s%.*llu%sInternal error: %s label header currently requires a data area.freeseg/freeseg.clabel/label.clabel allocaction failed%s: Failed to read label areaLABELONE%s: %s label detected%s: No label detectedUsing cached label for %sFailed to write label to %sIgnoring additional label on %s at sector %llu%s: Label for sector %llu found at sector %llu - ignoringLabel checksum incorrect on %s - ignoringLabel handler does not support label writesLabel sector %llu beyond range (%ld)%s: Writing label to sector %llu with stored offset %u.Scanning for labels to wipe from %s%s: Wiping label at sector %lluFailed to remove label from %s at sector %lluCouldn't allocate memory for labeller list object.locking/locking.csigprocmask_block_signalssigfillset%s/lvm/VGs/%sUnrecognised lock scope: %dFailed to activate %sglobal/locking_typeglobal/wait_for_locksNon-blocking External locking selected.Cluster locking selected.Internal error: Use of P_orphans is deprecated.Internal error: P_%s referencedLVM1 proc VG pathname too long for %s%s exists: Is the original LVM driver using this volume group?Internal error: %s: LCK_NONE lock requestedWARNING: Locking disabled. Be careful! This could corrupt your metadata.%sFile-based locking selected.global/fallback_to_clustered_lockinglocking/fallback_to_clustered_lockingFalling back to internal clustered locking.Read-only locking selected. Only read operations permitted.Unknown locking type requested.global/fallback_to_local_lockinglocking/fallback_to_local_lockingWARNING: Falling back to local file-based locking.Volume Groups with the clustered attribute will be inaccessible.Locking disabled - only read operations permitted.F IGGF_lock_vollocking/no_locking.cLLLL MM/MWrite locks are prohibited with --ignorelockingfailure.activate_log filefailed to write log file: %s failed to write log file #%s:%d %s:%d %s%slog/log.cvsnprintf failed: skipping external logging functionV\WWXJXName allocation failed - device not clearedName too long - device not cleared (%s)Clearing start of logical volume "%s"%s: not found: device not clearedFailed to find segment for %s extent %uLV %s in VG %s is now visible.%s:%u is no longer a user of %sparallel_areas allocation failedIncompatible layer boundary: %s:%u[%u] on %s:%ulayer segment for %s:%u not foundUnable to allocate logical volume structureFailed to allocate segment listMaximum number of logical volumes (%u) reached in volume group %sFailed to generate unique name for the new logical volumeUnable to create LV %s in Volume Group %s: name already in use.Cannot rename internal LV "%s".Logical volume "%s" already exists in volume group "%s"Failed to allocate space for new nameCannot rename "%s": name format not recognized for internal LV "%s"allocate_extents does not handle virtual segmentsMetadata format (%s) does not support required LV segment type (%s).Consider changing the metadata format by running vgconvert.Striped mirrors are not supported yetCan't mix striping with a mirror log yet.allocation handle allocation failedallocation pool creation failed_allocate called with no work to do!Parallel PVs at LE %u length %u: %sNot enough PVs with free space available for parallel allocation.Consider --alloc anywhere if desperate.Couldn't allocate areas array.Insufficient free space: %u extents needed, but only %u availablealloced_area allocation failedInsufficient suitable %sallocatable extents for logical volume %s: %u more requiredInsufficient extents for log allocation for logical volume %s.Remove %s:%u[%u] from the top of LV %s:%uSegment extent reduction %unot divisible by #stripes %uCan't remove logical volume "%s" under snapshotCan't remove logical volume %s used by a mirrorCan't remove logical volume %s used as mirror logCan't remove open logical volume "%s"Do you really want to remove active %slogical volume %s? [y/n]: Unable to deactivate logical volume "%s"Error releasing logical volume "%s"Failed to refresh %s without snapshot.Logical volume "%s" successfully removedRemoving layer %s for segments of %sLayer status does not match: %s:%u status: 0x%x/0x%xLayer boundary mismatch: %s:%u-%u on %s:%u / %u-%u / alloc_lv_segment: Missing segtype.Inserting layer %s for segments of %s on %sMatched PE range %s:%u-%u against %s %u len %uFailed to insert segment in layer LV %s under %s:%u-%uLog segments can only be added to an empty LVCouldn't allocate new mirror log segment.Can't convert non-striped segment to mirrored.Can't convert striped segment with multiple areas to mirrored.Couldn't allocate converted LV segmentMirror layer must be inserted before adding mirrorsFailed to allocate widened LV segment for %s.Failed to split segment at %s extent %uCouldn't allocate new zero segment.layer name allocation failed. Remove new LV and retry.Creating transient LV %s for mirror conversion in VG %s.Creation of transient LV %s for mirror conversion in VG %s failed.Failed to write intermediate VG %s metadata for mirror conversion.Failed to commit intermediate VG %s metadata for mirror conversion.Failed to resume transient error LV %s for mirror conversion in VG %s.Missing segtype in lv_add_segment().lv_add_segment cannot handle virtual segmentsCouldn't allocate new LV segment.Couldn't merge segments after extending logical volume.Aborting. Failed to extend %s.Zero segment type for virtual origin not foundVirtual origin name allocation failed.Metadata does not support mirroring.Reducing requested stripe size %s to maximum, physical extent size %sRounding size (%d extents) up to stripe boundary size (%d extents)Can't wipe start of new LV without using device-mapper kernel driverCan't create snapshot without using device-mapper kernel driverClustered snapshots are not yet supported.Can't share virtual origins. Use --virtualsize.Snapshots of snapshots are not supported yet.Snapshots of locked devices are not supported yetSnapshots and mirrors may not yet be mixed.Check for existence of snapshot origin '%s' failed.Unable to create new logical volume with no extentsInsufficient free extents (%u) in volume group %s: %u requiredNumber of stripes (%u) must not exceed number of physical volumes (%d)Can't create mirror without using device-mapper kernel driver.WARNING: New mirror won't be synchronised. Don't read what you didn't write!Setting device number to (%d, %d)Aborting. Failed to activate snapshot exception store.Aborting. Failed to activate new LV to wipe the start of it.Aborting. Couldn't deactivate snapshot COW area. Manual intervention required.Couldn't create virtual origin for LV %sUnable to deactivate failed new LV. Manual intervention required.Manual intervention may be required to remove abandoned LV(s) before retrying.Failed to find snapshot segtypeCouldn't allocate new snapshot segment.%s is expected to have only one segment using it, while it has %d%s is expected to have only one segment using it, while %s:%u uses it %d timesmetadata/lv_manip.cCan't move snapshot segmentLV %s in VG %s is now hidden.Adding %s:%u as an user of %sStack %s:%u[%u] on LV %s:%upv_list allocation failedCreating logical volume %sCannot rename locked LV %sFailed to create new namedm_pool_begin_object faileddm_pool_grow_object failedcontiguous Can't remove locked LV %sLogical volume %s not removedRemoving snapshot %sReleasing logical volume "%s"Failed to resume %s.Layer segment found: %s:%uLayer is not linear: %s:%uMissing error segtypeInserting %s:%u-%u of %s/%sanyConflicting region_sizeCreation of layer LV failedInserting layer %s for %s%s_voriginStripe size may not exceed %slvol%dFailed to generate LV name.Setting read ahead sectorsFailed to activate new LV.snapshot exception storestart of new LVAborting. Failed to wipe %s.Logical volume "%s" createdRemoving layer %s for %sFailed to find layer %s in %sSegment with extent %u in LV %s not foundCouldn't allocate cloned LV segment.LV segment tags duplication failedSplit %s:%u[%u] at %u: %s LE %uSplit %s:%u[%u] at %u: %s PE %uUnassigned area %u found in segmentUnable to split the %s segment at LE %u in LV %sLV %s invalid: segment %u should begin at LE %u (found %u).LV %s: segment %u has inconsistent area_len %uLV %s: segment %u has log LV but is not mirroredLV %s: segment %u log LV %s is not a mirror logLV %s: segment %u log LV does not point back to mirror segmentLV %s: segment %u mirror image is not mirroredLV %s: segment %u has same LV %s for both origin and snapshotLV %s: segment %u has unassigned area %u.LV %s: segment %u has inconsistent PV area %uLV %s: segment %u has inconsistent LV area %uLV %s: segment %u mirror image %u missing mirror ptrLV %s segment %d uses LV %s, but missing ptr from %s to %sLV %s has duplicated links to LV %s segment %dLV %s is used by LV %s:%u-%u, but missing ptr from %s to %sReference count mismatch: LV %s has %d links to LV %s:%u-%u, which has %d linksLV %s: inconsistent LE count %u != %uLV segment %s:%u-%uis incorrectly listed as being used by LV %smetadata/merge.c#metadata/metadata.cpv allocation for '%s' failed free space allocated space PV segment start PV segment length area length extents moved pvseg start pvseg length area startVolume group %s is exportedVolume group %s is read-onlylvm2 vg_handleError allocating vg handle.vg_read orphanvg allocation failedvg name allocation failedFound volume group "%s"Volume group "%s" not foundPV list allocation failedget_pvs: get_vgids failedPhysical volume %s not foundMaxLogicalVolume limit is 255Wiping swap signature on %sZeroing start of device %s%s not wiped: abortingInvalid vg name %slvm2 vg_createvg_remove_mdas %s faileddevices/md_chunk_alignmentAttempt to modify a read-only VGFormat does not support writing physical volumesAssertion failed: can't _pv_write non-orphan PV (in VG %s)Calculated readahead of LV %s is %uVolume Group allocation policy cannot inherit from anythingVolume group "%s" must be resizeable to change MaxPhysicalVolumesMaxPhysicalVolume limit is 255MaxPhysicalVolumes is less than the current number %d of PVs for "%s"New size %llu for %s%s not an exact number of new extents.New extent count %llu for %s%s exceeds 32 bits.Device %s not found (or ignored by filtering).Could not find LVM label on %sFound label on %s, sector %llu, type=%sNo physical volume label read from %sFailed to read existing physical volume '%s'Volume group "%s" must be resizeable to change PE sizePhysical extent size may not be zeroPhysical extent size must be a power of 2.New extent size is not a perfect fitAttempt to drop cached metadata failed after reverted update for VG %s.Skipping clustered volume group %sVolume group %s is not resizeable.Internal error: global memory pool used for VG %svg->name allocation failed for '%s'pv->vg_name allocation failed for '%s'pv_list allocation for '%s' failedInternal error: Attempt to write new VG metadata without locking %sAttempt to drop cached metadata failed after commit for VG %s.Volume group %s contains snapshots that are not yet supported.Internal error: Duplicate PV id %s detected for %s in %s.Internal error: VG name for PV %s is corruptedInternal error: PV segments corrupted in %s.Internal error: #internal LVs (%u) != #LVs (%u) + #snapshots (%u) + #internal LVs %u in VG %sInternal error: Duplicate LV name %s detected in %s.Internal error: Duplicate LV id %s detected for %s and %s in %s.Internal error: LV segments corrupted in %s.Internal error: Volume group %s has limited PV/LV count but limit is not set.Cannot update partial volume group %s.Cannot update volume group %s while physical volumes are missing.Cannot update volume group %s with unknown segments in it!Aborting vg_write: No metadata areas to write to!Unable to drop cached metadata for VG %s.Format does not support writing volumegroup metadata areasInternal error: vg_read_internal requires vgname with pre-commit.Failed to create format instanceThere are %d physical volumes missing.Cached VG %s had incorrect PV listInconsistent pre-commit metadata copies for volume group %sInconsistent metadata UUIDs found for volume group %sWARNING: Inconsistent metadata found for VG %s - updating to use version %uMissing device %s reappeared, updating metadata for VG %s to version %u.Device still marked missing because of alocated data on it, remove volumes and consider vgreduce --removemissing.Automatic metadata correction failedAutomatic metadata correction commit failedRemoving PV %s (%s) that no longer belongs to VG %sWARNING: Interrupted pvmove detected in volume group %sPlease restore the metadata by running vgcfgrestore.Updating cache for PVs without mdas in VG %s.Finding volume group for uuid %sVolume group %s metadata is inconsistentvg_read_by_vgid: get_vgnames failedVolume group for uuid not found: %sCan't find logical volume id %sVolume group "%s" inconsistent.Recovery of volume group "%s" failed.Cannot change VG %s while PVs are missing.Consider vgreduce --removemissing.Cannot change VG %s with unknown segments in it!WARNING: Volume Group %s is not consistentPhysical volume %s not in a volume groupget_pv_from_vg_by_id: vg_read_internal failed to read VG %sWARNING: Volume group %s is not consistentinternal PV duplication failedLogical volumes in "%s" must be inactiveExtent sizes differ: %d (%s) and %d (%s)Maximum number of physical volumes (%d) exceeded for "%s" and "%s"Maximum number of logical volumes (%d) exceeded for "%s" and "%s"Metadata types differ for "%s" and "%s"Clustered attribute differs for "%s" and "%s"Duplicate logical volume name "%s" in "%s" and "%s"Physical volume %s might be constructed from same volume group %s.Volume group "%s" must be resizeable to change MaxLogicalVolumeMaxLogicalVolume is less than the current number %d of LVs for %sFailed to create random uuid for %s.%s: Pretending size is %llu sectors.%s: Data alignment must not exceed device size.%s: Format-specific setup of physical volume failed.uuid %s already in use on "%s"Can't initialize physical volume "%s" of volume group "%s" without -ff%s: physical volume not initializedCan't open %s exclusively. Mounted filesystem?Software RAID md superblock detected on %s. Wipe it? [y/n] Wiping software RAID md superblock on %sFailed to wipe RAID md superblock on %sFatal error while trying to detect software RAID md superblock on %sSwap signature detected on %s. Wipe it? [y/n] Failed to wipe swap signature on %sFatal error while trying to detect swap signature on %sWARNING: Forcing physical volume creation on %s%s%s%s%s not opened: device not zeroedPhysical volume %s not in volume group %sLogical volume %s not in volume group %sVolume too large (%s) for extent size %s. Upper limit is %s.%s: already exists in filesystemNew volume group name "%s" is invalidNumber of volumes may not exceed 255A volume group called '%s' already exists.Couldn't create uuid for volume group '%s'.Format specific setup of volume group '%s' failed.New volume group path exceeds maximum length of %d!Old and new volume group names must differPhysical volume %s not in volume group %s.Physical volume %s still in use.Unable to remove physical volume '%s' from volume group '%s'.Volume group "%s" not found, is inconsistent or has PVs missing.Consider vgreduce --removemissing if metadata is inconsistent.Volume group "%s" still contains %u logical volume(s)Removing physical volume "%s" from volume group "%s"Failed to remove physical volume "%s" from volume group "%s"Volume group "%s" successfully removedVolume group "%s" not properly removeddevices/data_alignment_offset_detection%s: Setting PE alignment offset to %lu sectors.devices/data_alignment_detection%s: Setting PE alignment to %lu sectors.Adding physical volume '%s' to volume group '%s'Physical volume '%s' is already in volume group '%s'Physical volume %s is of different format type (%s)Physical volume %s might be constructed from same volume group %sFormat-specific setup of physical volume '%s' failed.Physical volume '%s' listed more than once.No space for '%s' - volume group '%s' holds max %d physical volume(s).Unable to add %s to %s: new extent count (%llu) exceeds limit (%u).%s not identified as an existing physical volumeUnable to add physical volume '%s' to volume group '%s'.Really INITIALIZE physical volume "%s" of volume group "%s" [y/n]? BInvalid index (%u) of mirror image supplied to shift_mirror_images()Aborting. Unable to create in-sync mirror log while activation is disabled.Aborting. Unable to deactivate mirror log.Aborting. Unable to tag mirror log.Aborting. Failed to activate mirror log.Failed to remove tag %s from mirror log.Aborting. Failed to wipe mirror log.Name allocation failed - log header not written (%s)Name too long - log header not written (%s)Writing log header to device, %s%s: not found: log header not writtenFailed to write log header to %sAborting. Failed to write mirror log header.Aborting. Failed to deactivate mirror log. Manual intervention required.Unable to deactivate mirror log LV. Manual intervention required.Manual intervention may be required to remove abandoned log LV before retrying.Manual intervention may be required to remove/restore abandoned log LV before retrying.log_count != 1 is not supported.mirror log name allocation failedFailed to initialise mirror log.img_name allocation failed. Remove new LV and retry.Aborting. Failed to create mirror image LV. Remove new LV and retry.Aborting. Failed to add mirror image segment to %s. Remove new LV and retry.Unable to determine mirror sync status of %s/%s.Unable to allocate extents for mirror(s).Aborting. Failed to add mirror segment. Remove new LV and retry.log_count > 1 is not supportedMultiple-segment mirror is not supportedUnable to convert the log of inactive cluster mirror %sUnable to allocate extents for mirror log.Segment is not mirrored: %s:%uSegment status does not match: %s:%u status:0x%x/0x%xIntermediate VG commit for orphan volume failed.Bad activation/mirror_log_fault_policyBad activation/mirror_device_fault_policyReducing mirror set from %u to %u image(s)%s.Incompatible parameters to _remove_mirror_imagesProblem suspending temporary LV %sProblem resuming temporary LV, %sFailed to initialize log deviceWARNING: Bad device removed from mirror volume, %s/%sWARNING: Failed to replace mirror device in %s/%sWARNING: Use 'lvconvert -m %d %s/%s --corelog' to replace failed devicesWARNING: Use 'lvconvert -m %d %s/%s' to replace failed devicesWARNING: Failed to replace mirror log device in %s/%sWARNING: Unable to find substitute device for mirror volume, %s/%sWARNING: Mirror volume, %s/%s restored - substitute for failed device found.WARNING: Mirror volume, %s/%s converted to linear due to device failure.WARNING: Mirror volume, %s/%s disk log removed due to device failure.No mirror images found using specified PVs.%u images are removed out of requested %u.Removing more than existing: %d <= %dPersistent log is not supported on segment-by-segment mirroringUnable to determine mirror sync status.Unable to convert the log of an inactive cluster mirror, %sFull resync required to convert inactive mirror %s to core log. Proceed? [y/n]: Using reduced mirror region size of %u sectorsUnable to allocate mirror extents for %s.Failed to add mirror areas to %sStriped-mirroring is not supported on segment-by-segment mirroringUnsupported mirror conversion typeFailed to find mirror_seg for %s%s on %s is not a mirror segmentsFailed to find mirrored LV for %sNot collapsing %s: out-of-syncFailed to release mirror imagesmetadata/mirror.clog_name allocation failed._mlogtmp_%dFailed to create mirror log.stripes > 1 is not supported_mimage_%dlvs list alloc failedAborting. Unable to tag.allocate_anywhere and no log volumeFailed to add mirror imagesAll mimages of %s are goneintermediate VG write failed.%u image(s) removed from %sNo conversion is requestedNot a mirror segment%s %u: %6u %6u: %s(%u:%u)metadata/pv_manip.cGap in pvsegs: %u, %uWrong lvseg area typeInconsistent pvseg pointersInconsistent length: %u %upv_segment allocation failedPV segment pe_count mismatch: %u != %uPV segment pe_alloc_count mismatch: %u != %uPV segment VG pv_count mismatch: %u != %uPV segment VG free_count mismatch: %u != %uPV segment VG extent_count mismatch: %u != %uSegment with extent %u in PV %s not foundNo change to size of physical volume %s.Resizing physical volume %s from %u to %u extents.%s: cannot resize to %u extents as there is only room for %llu.%s: cannot resize to %u extents as %u are allocated.%s: cannot resize to %u extents as later ones are allocated.release_pv_segment with unallocated segment: %s PE %uMissing PV segment on %s at %u.metadata/pv_map.cto_go <= pva->countcreate_pv_maps alloc failedpvl->pv->devAllowing allocation on %s start PE %u length %uCouldn't create physical volume maps in %sconsume_pv_area_create_mapsmetadata/segtype.cWARNING: Unrecognised segment type %sFailed to remove internal snapshot LV %s'%s' is already in use as a snapshot.Snapshot and origin LVs must differ.metadata/snapshot_manip.csnapshot%dd n;0&AvQkkXaM %ssymlinkCreating directory %smkdirRemoving directory %sCouldn't determine link pathname.The link %s should have been removed by udev but it is still present. Falling back to direct link removal.%s not symbolic link - not removingCouldn't create path for volume group dir %sCouldn't create source pathname for logical volume link %sCouldn't create destination pathname for logical volume link for %sCouldn't create pathname for LVM1 group file for %sNon-LVM1 character device found at %sSymbolic link %s not created: file existsSymlink %s that should have been created by udev does not have correct target. Falling back to direct link creationSymlink %s that should have been created by udev could not be checked for its correctness. Falling back to direct link creation.The link %s should had been created by udev but it was not found. Falling back to direct link creation.Couldn't construct name of volume group directory.No space to stack fs operationExternal locking already initialisedShared library %s does not contain locking functionsWARNING: %s: _query_resource() missing: Using inferior activation method.Loaded external locking library %slocking/external_locking.cliblvm2clusterlock.soglobal/locking_librarylocking_initlock_resourcereset_lockinglocking_endquery_resourceglobal/library_dirmisc/sharedlib.cOpening shared %s library %sNot loading shared %s library %s in static mode.Unable to open external %s library %s: %sdatastruct/btree.c%s/dev/block/%d:%d/md/%sdm_snprintf md %s faileddevice/dev-md.c%s/block/md%d/md/%sdm_snprintf old md %s failedfgetsDevice %s %s is %lu bytes.raid%dDevice %s %s is raid%d.raid_disksDevice %s %s is %d.%s sysfs attr %s not in expected format: %sDevice %s has an unknown md raid level: %dDevice %s stripe-width is %lu bytes.\device/dev-swap.cSWAP-SPACESWAPSPACE2S1SUSPENDS2SUSPENDULSUSPENDV device/device.c%s/dev/block/%d:%d/partitiondm_snprintf partition failedreadlink%s/block/%s/devdm_snprintf dev failedsysfs file %s does not exist%s/dev/block/%d:%d/%sprimary dm_snprintf %s failedqueue/optimal_io_sizequeue/minimum_io_sizealignment_offsetsysfs file %s not in expected MAJ:MIN format: %ssysfs file %s not in expected format: %sunknown/unknown.cimporting unknown segmentformat_text/archive.cFile: %sUnable to read archive file.VG name: %sDescription: %sBackup Time: %sArchive file %s not found.No archives found in %s.%s/%s_%05u.vgArchive file name too long.Archive rename failed for %sExpiring archive %sCouldn't create text instance object.Couldn't scan the archive directory (%s).Couldn't create new archive file.Couldn't create temporary archive name.Couldn't create FILE object for archive./var/lock/lvmglobal/locking_dirglobal/prioritise_write_locksinit_file_lockinglocking/file_locking.csigdelset_undo_flock %sUnlocking %sflocksignal_remove_ctrl_c_handler_do_flock %s %c%c%s/P_%s%s/V_%sUnrecognised lock type: %dLocking %s %c%cUnlocking LV %sLocking LV %s (NL)Locking LV %s (R)Locking LV %s (PR) - ignoredLocking LV %s (W)Locking LV %s (EX)nJJH(KlKKLCTRL-c detected: giving up waiting for lockformat1/disk-rep.cInvalid PV structure size.Failed to write VG data to %sToo many uuids to fit on %slv_number %d too largeFailed to write LV's to %sFailed to write extents to %sSuccessfully wrote data to %sDuplicate PV %s - using %s %sFailed to read LV's from %sFound %s in %sVG %sCouldn't allocate temporary PV buffer.Writing %s PV metadata to %s at %llu len %zuFailed to write PV structure onto %sWriting %s VG metadata to %s at %llu len %zuWriting %s uuidlist to %s at %llu len %dFailed to write PV uuid list to %sCouldn't zero lv area on device '%s'Writing %s LV %s metadata to %s at %llu len %zuWriting %s extents metadata to %s at %llu len %zuIgnoring duplicate PV %s on %s%s does not have a valid LVM1 PV identifierformat1: Unknown metadata version %d found on %sFailed to read PV data from %s%s is not a member of any format1 VGFailed to read VG data from PV (%s)%s is not a member of the VG %sFailed to read PV uuid list from %sFailed to read extents from %sread_pvs_in_vg: dev_iter_create failedCalculated uuid %s for %sformat_pool/disk_rep.cpool read_vgUnable to allocate pool list structureUnable to allocate %d 32-bit uintsNo devices for vg %s found in cache/;(&uD& vd&Pv&@z&&P& '0'T'p'P'''`'(4(T( t(((0(()p@) d)`))))0)*8* \*|**0**+$+@+`+++++p, ,<,pX,x,,P, ,@,-@-$\-@%|-'-@(-`(-(-(. )<.p)`.0*.*.P+.,.-/@- /-D/.d/./@/L/0M/M 0R,0SH0Sd0pT0Y0\0y0z 1|,1|H1~l11111242pT2x2 2P2203(3H3l3Ч33@3034`44T4Pt40444450<5X5t55055p5p686@T6Pp6`66066P7@7d77P77`78(8H8p h8 8@8p88 9p09pP9@p9"90#9&9 *9-:`.4:0X:A|:B:B:pI:@K;U$;WH;0Yl;Z;P[;_;`;b<b@<j`<`k<0l<m<@r< =p0=L=p=Њ=Ћ= =>P$>@> d>>>>@>p?0?`P?p?P?p??? @,@P@t@@@@ж@A(ALApAAAA AB0BTB0xBPBpBBB C,CPCptC`CCCCPD`4DTDtDDDpDD@E0E PE`lEE`EE@E F@0FTFtFFF`FF`G8G`XGtGGGGG`H@H\H`|HPHHHH@ I@I0`IIIIpIJ(JLJpJJ@J JJ@'K`)@K.dKp/K@2K5K6K6L7(LBHL ChL0CL`CLCLCL0DLDMpEp>>?@$PADAdpBCLȋNpP Q,pQP`UtXY@[،[ \\0^P`pbpbl؍Ppqps<u`0v xyȎz| |,@LpP̏PP0pTpPؐ@@`4Pl@đp,`L0l `В` 0PPtХȓ0P8pTpЦĔ@`4Pl @ܕ`0Lh @ؖ@p8Tt@ȗ0,`Pl0Ș0г ,Lp`ę0`p8Tp0̚,Hd@0ԛ``4Plp@Ĝ (pD`p0<``|؞ Dh@@ȟ,PLp@ PР P0Tpt ܡ @`pp@$Hdpܣ 0Ll ̤0PtpХ 0 P lPЦ@0P p"/ /̧@//0( 3H`3dp333 4Ԩ506747P8lP99:̩0AB `C,0HLHlJKM̪M N@N N<OXOx0PPpRثRSS0TPZt\@_cجccd4dP epfghܭij$`lHldlnnno`p,rL0rhPrssuv@w,yL }l}Pа04ЈXxЋܱ<`0ܲP@ dpij0<p`Pȴ p ,P`p@̵p0 (PL0p`Ķ@4T`xp`ܷp@@0`0`ظpP4P0p``Թ00pP@p @ԺP` @( H h0Ļ 8` X0!| "0$p.0`0@1<3\5|8:0?ܽ?@ B<PC\zR| 4OAB B<O(AB AXOAB C xSAB ACC 4XAAB ACC `Zk AB IE cAB AD HgXAB II,z AG  Hxz]AB IXlz*AB Bz0AB AzAB F h|GAB FSE}WAB F ~AB O,TfAB FL AB C lTAB FITAB FNPAB C AB IQH lAB FNF (AB FNF<1AB DXMAB At AB 2AB D4AB  8LAB FQF dLAB FQF LAB FQF4`AB IQT`AB IQ tAB GED)AB  `)NAB AG )AB FNF)(>AB GE)HAB )LhAB A*!AB C *AB IED*|AB AC d*lAB AG*AB F* AB A *< AB II* >AB FF + %AB AG,++AB A H+AB IE l+jAB FNE +qAB AD +LAB BC+H%AB F +XAB FQ ,D7AB FQ@,`AB FQ `,AB IIN,AB FQ4> 4AB A P>0AB FNEt>AB FF><AB E>3AB D> AB F>4AB A ?4AB FQ0?~AE AL?dAB Cl?AB C?tAB ?xAB ?|?AB A?rAB RF@AJ @AB 8@^AG DT@AB F l\T:AB AD \ <]AB FNF\\<=AB J\|<)AB D\<@AB A ]<+AB A(]<AB FH]C AB F h]DAB FNF ]EAB FQE] GAB ]$G~AB FF ]GAB FPE ^pHAB FI4^lIAB F T^RAB RL{?AB FQ l{d@AB FI {`AAB FFN{BAB F {C>AG ED{CAB F|xD,AG FG8|DAB CX|8EAD Bx|EAD K |8FaAB BC |FdAD AD|FWAB D |GxAB HD }pGAB <}dGAB  X}hGAB FQ|}H#AB A}(HqAB A}HUAB A}H1AB D}HAB ~HZAG D$~,I\AB CD~lJ#AB A `~JAB FI~\KAB C~LN AB C ~XAB LF~xYAB EHZuAB F (\AB LFL4^AB Cl_"AB _7AB AD`AB E`AB Fb AB FxcAB C(Hf)AB AD\fAB CdgAB F iAB FQE(j?AB FȀHn:AB Fhp@AB CqAB C(huQAB FHvAB Chhz AB CHDD LAF PdAB A ܁<AB IQ'AB C Њ9AB A<AB X#AB AtAB TAB ADxAB ĈAB FNAB C AG (AB DGAB Cd#AB A ЏAB FI̐AB Că<AB CAD B,AB F$ܝAB FD|AB Fd,AB F,AB C AB #AB A܄AB eAB GlTAB A0AB OTP AB FNpAB A AB I\YAB A̅ԦAB AxVAB FAD HP (AB AJLtAB C lAB AGAB I AB  ̆AB FQ#AB A ԶqAB A(8AB FN HAB F_ ldAB FQJ AB FFN AB FQ ؇AB FQ tAB LE AD <AG  XSAB FL|TAB  HAB FQ AB FQ AB FQ,AB O$AD @AG \MAB R|#AB A >AB FI $AB I]F AB FNE ZAB F$LzAB FDAB FQdAB C cAB FFNAB FȊiAB C AB FTE AB AG0pAB ACP`#AB A ltAB FPE @AD IQLAB Ћ AB F AB BI \AB FNE8XjAB IXAB Ex AB CAB  EAG FQF،DAG D ,AG FNF :AB BI<AB AC\AB C|4AB FAB AAB Aԍ%AB D EAB FQ <AB INF8AB C XAB ACC |(AB IHNAB C 0NAB FNE\AB C AB FO(DAB FOHPAB FFhPAB FFH:AD Al$AB A AB FNFdAB A pAB II $AB IQFH(TH d5AB G-AB  AB AB ԐAB !AB  AAB FN ,4AB FTP AB m p#AB FQJ<&TAB FN|&AB Cԑl(AB F *!AD AJ,AB I 81AB OI[\D7"AB AxX7"AB Al7"AB A7AB  ̒t7AB FQ08#AB A D81AB D(h8gAB CH9-AB D d9AB FNE :/AB ACC<AB E̓4=yAB A=AB CXAAB F(BAB IHGAB C hIAB INI$K`AB CdL AD ȔXLAG LLAB AMAB I PAB F @Q"AB LcFdWMAB AWAB WAB WAB ԕWAD WK AB Ib8AB F 0dAB FEUTdAB E t|eAB FQFhg6 AB IqAB FؖsHAE @П@) T @R % P8`1Jܨ`P 00W(>O!4@5Dh`ޅ0Fdޅ@,>P{`l@4>څ #ɲ``P}ga?_0# 8p5P̯Sۯد`U(U:5+`1D0z\`òS5P;0Pk 0@9]@EPTpap0P@Vz@(5p؃0k =ٳVp 'a j@ͳp50]p޹ `0p0 ppkݹ`_p`05MЀ X 0 bApƲ0p9 p`+g5 ۯ `<@[`dh0`+%w`V _0P0{вЦPK`p0`ѯ4pN( p4Ѕ_ #Wگ0j 9Pگ@;`UP|ٹ p5C  К)p`pp0P%(p<$3@<>p5p d haCa) ) ) `) ) )  *  * `!*  /*  =* L* V* c* p* {*  * * * * @* @* * * * * *  * * + + +  %+ .+ =+ G+  P+ ]+ p+ + + + + + `+ `+ + + a+ a , A, A, b3, b@, cN, cZ, cf, Cn, Cx, d, e, E, f,  f, f, h, ? I, i,  i,  i, l,  l-  l- pl$- l3- L:- `LA- MQ- j^- Pmf- Mp- m- n-  n- n- n- o-  O-  p- 0p-  P- P- r- r . R. R. `s*. `s?. sG. sR. tZ. ua. ua.  Uh. vs. V}. x. x. y. Z. -  `` Cfb@Pp@PY dkpv Pkp@ d@@] Pa d : 0:  O p 9 @9 8 @2 @0 0- - , " " "  "  P p  @ @9 @2 @. 0- ` |  | z     `  0 p P   &lv_uuidLV UUID` lv_nameLVp Plv_attrAttr  \lv_majorMaj  `lv_minorMin  lv_read_aheadRaheadЅ lv_kernel_majorKMaj Dlv_kernel_minorKMin`  lv_kernel_read_aheadKRahead  dlv_sizeLSizeP  seg_count#Seg` 0originOrigin  origin_sizeOSize $ snap_percentSnap% ` copy_percentCopy% move_pvMove ȇconvert_lvConvert@ lv_tagsLV TagsPy Jmirror_logLog0 @modulesModules0 x pv_fmtFmtP X &pv_uuidPV UUID`  dev_sizeDevSize   pv_namePV j pv_mda_freePMdaFree ؈ pv_mda_sizePMdaSize  \pe_start1st PEP T pv_sizePSize p pv_freePFreeЂ  pv_usedUsed0 Lpv_attrAttr  dpv_pe_countPE~  hpv_pe_alloc_countAlloc~ |pv_tagsPV TagsPy J pv_mda_count#PMda0 Dvg_fmtFmt X&vg_uuidVG UUID` 0vg_nameVG jvg_attrAttr  vg_sizeVSize p vg_freeVFree@ 4vg_sysidSYS ID Ċ @vg_extent_sizeExt  Dvg_extent_count#Ext~  Hvg_free_countFree~ $ Lmax_lvMaxLV~ T Pmax_pvMaxPV~  Tpv_count#PV~  lv_count#LV  snap_count#SN  vg_seqnoSeq~ ċhvg_tagsVG TagsPy J vg_mda_count#VMda`   vg_mda_freeVMdaFree 8 vg_mda_sizeVMdaSize0 psegtypeTypex  stripes#Str~  stripesizeStripe Ԍ stripe_sizeStripe Ԍ <regionsizeRegion $ <region_sizeRegion $ chunksizeChunk h chunk_sizeChunk h seg_startStart`  seg_start_peStart   seg_sizeSSize 0Lseg_tagsSeg TagsPy J seg_pe_rangesPE Ranges~ TdevicesDevices~  pvseg_startStart~ ؎ pvseg_sizeSSize~ Ԅ  @  @   0  p @           0 @ 0 0  @ 0 @  @ @    P    p  0  ` 0 @    " &  % @$ # 0# # + + +  - @ p? @< < 8 `6 04 2 2 p1 P1 01 88 P   p lvm.debugy8ELF34tF 4 (444444  xE8   HHH Ptd ?  ,&,&Qtd44,HH :ohhY   >U:aoJJon ,,h  ##3D Ȅ     ? ,&"LLe T   w      (( 4\\  ; xE x JxE E .data.rodata.shstrtab.dynamic.eh_frame.note.ABI-tag.gnu.hash.fini.gnu_debuglink.dynsym.gnu.version.rel.dyn.data.rel.ro.interp.gnu.version_r.jcr.eh_frame_hdr.dynstr.ctors.dtors.bss.init.rel.plt.got.plt.got.text.gnu.liblist.gnu.conflict.gnu.prelink_undo4q4,HqH :ohqhY   >oUddV e:aoJJon ,,h  ##3D Ȕ     O ,&"LLu T   w       (( 4\\  ; xU x JxU U lZ 

:: Command execute ::

Enter:
 
Select:
 

:: Shadow's tricks :D ::

Useful Commands
 
Warning. Kernel may be alerted using higher levels
Kernel Info:

:: Preddy's tricks :D ::

Php Safe-Mode Bypass (Read Files)

File:

eg: /etc/passwd

Php Safe-Mode Bypass (List Directories):

Dir:

eg: /etc/

:: Search ::
  - regexp 

:: Upload ::
 
[ Read-Only ]

:: Make Dir ::
 
[ Read-Only ]
:: Make File ::
 
[ Read-Only ]

:: Go Dir ::
 
:: Go File ::
 

--[ c999shell v. 1.0 pre-release build #16 Modded by Shadow & Preddy | RootShell Security Group | r57 c99 shell | Generation time: 0.007 ]--