!c99Shell v. 1.0 pre-release build #16!

Software: Apache/2.2.3 (CentOS). PHP/5.1.6 

uname -a: Linux mx-ll-110-164-51-230.static.3bb.co.th 2.6.18-194.el5PAE #1 SMP Fri Apr 2 15:37:44
EDT 2010 i686
 

uid=48(apache) gid=48(apache) groups=48(apache) 

Safe-mode: OFF (not secure)

/sbin/   drwxr-xr-x
Free 40.47 GB of 127.8 GB (31.66%)
Home    Back    Forward    UPDIR    Refresh    Search    Buffer    Encoder    Tools    Proc.    FTP brute    Sec.    SQL    PHP-code    Update    Feedback    Self remove    Logout    


Viewing file:     grub (288.55 KB)      -rwxr-xr-x
Select action/file-type:
(+) | (+) | (+) | Code (+) | Session (+) | (+) | SDB (+) | (+) | (+) | (+) | (+) | (+) |
ELF4X}4 (44p4p44q4qpp```4$`HHqHq PtdP5PP| | Qtd/lib/ld-linux.so.2GNU __gmon_start__libc.so.6_IO_stdin_usedfflushstrcpyexitsprintf_IO_putcsetlocalefopenstrncmpstrrchr__strdupcfmakerawperrormmap64nanosleepftell__read_chkstrncpysignalsigprocmasktime__stack_chk_failputcharselectreallocstdingetpidkill__assert_failisattyfeofcfsetispeedfgetscallocstrlensigemptysetmemsetcfgetospeedgetcharstrstr__errno_locationtcsetattrfseeklongjmp__fxstat64_setjmp__fprintf_chksigaddsetstdoutfputcfputsmemcpyfclosemprotect__strtol_internal__vsnprintf_chkstrtoulmallocstrcatrealpathnl_langinfo__xstat64getenv__ctype_b_locsscanfoptargstderrioctlmunmapgetopt_longstrncatfilenofwritefreadgettimeofdaysigactionsigismemberatoitcflushlseek64strchr__vfprintf_chktcgetattr__strcpy_chksetvbuf__sprintf_chkcfsetospeedmemmovefopen64accesssyncstrcmpstrerrortcgetpgrp__libc_start_mainvfprintfsysconffreeGLIBC_2.4GLIBC_2.3GLIBC_2.2GLIBC_2.3.4GLIBC_2.1GLIBC_2.0/lib/ld-linux.so.2M:Mq5.^^^^^_$4_8_<_L_______̿п0Կؿܿٳi+&"ijm)K8gUa4Ik=M<46Iw\/n n=16Dg@/<z)qIC.2E\e. zv0=6=a)wG2j?G<?2!b0R@v'Q F6W2M0"mp9+xo_o$d *pChj&XPD|U4 2]nQDp==soWB%mW7lT $c\ii ii ii ti ii ii klim       $ (!,"0#4$8%<&@'D(H)L*P+T,X-\.`/d0h1l2p3t4x5|6789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXY Z[\]^ _$`(a,b0c4d8e<f@gDhUL 5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`% hP%h@%h0%h %h% h%$h%(h%,h%0h%4h%8h %<h(%@h0%Dh8p%Hh@`%LhHP%PhP@%ThX0%Xh` %\hh%`hp%dhx%hh%lh%ph%th%xh%|h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`% hP%h@%h0%h %h% h%$h%(h%,h%0h%4h%8h %<h(%@h0%Dh8p1^PTRhPh`QVh US[ItX[ÐUS=u?-X9v&9w[]Ít&'Utt $ÐUSÃtPP5h,555 hWk$L$qUWV1SQyE0   jhhlFWu Í@W$t1<ǃ h%$nt PPj5h_Sjj5@W hu$Qjj5  l 5Cot<=t.RP5hf j)Ru=u `@ PU]U]U]U]á4U]lU}]% U ]US] Ux~ 1#kQjPRS1H!‹]U]U1]U]U1]U1]U1]11Ƀ=Ut tJ]% U1}]H%@U]U]U]U]U1]U]U]UDt P uDUWVS u<} t Pk8D0t P8D0u< W<Ze[^_]UWVSL] =D}`x POQQh5D`pRRuVP: VKt`tB%tD` "tL(   0}Et}t}eM EE}t}uXeM@P1E1Pj5`?t-W8WhPFuڰ 5`1`d1`QQV]SXZVSEσE  뢃uk8e[^_]UWVSEPUMu2SVuW0 VWu# 8uE)ƅuʋ]e[^_]UWVS(EPUMM6'PuVuV h8u)Eƃ}uӋ]VuWue[^_]UWVS E}@E@kU 8M;LnEjRPu9P9HE}‰Et }D}u*~%UE=UOE =U 1ۡ<14RuWh MYUFRƒRPhQ9ut/u'E Ch. 1hj;uu hj=u:UE 9t$PPuh 11e[^_]UWVS 8kuD0C<U<Y=tPWRhp =uPPh@W8C8{u@=u ttHuPPh@WOC8|0uQQ[ h\ hÍ%P8t0x=t/8 t08D0XZju_8xtWu5<P+ SU8D0t)QjhaP 58jVu B1e[^_]U=t 5 '?U]U=tPuu 5 8RU]US]tIt4u\NtBuP4tA'w1*v(-!|<> ^+= u9 tHB; u RRjPSw SQRPhQljDX@t= tB@;Ī u j $ PP @PPS5 z=렃 t ]]]U]UVSjEPR] ։ؙk )Ӻi@BEei[^]iѶUjWU=tU>QQjh`UEUE`HtU1 Wp׉h`ƒpEPjjpP`EE@P[ ~`UwHt2U}UUUUUUUUĉLh`uH=t HLUWVS=4thhh6h@c j1҃ø@@t %@؍=Rt)=tJ=JuV:=St =huF?=6/(! US=tHdt dBSSj5 hY5 EXZjd5 KÃu<.xt?ut.Rt4tFJuXCSthuF=6/(! ؋]U]U1}]H%@ÐUE WMV}Sxt X uydu w-1҉ BWB01҉Fu^ AKQA9w[^_]UWVSu}k%tFaQAE stB ct4dutxu=7]PS7ڃ BFuFF@uM AE u+ue[^_]Ux;}4i@1]UUBw ]UM wu1]UM SU]8}~ CAJu1[]UW}VuS] B9| <:t9} BAtC19D7}D71[^_]UUE :}~B@ u8u1]á`U]H`U]HUS] u j hyD `@г) j KuPdh9 hhj`@$t jЃ h`@$t jЃ% t u h-Lh]`]H ]US] PCu]UVSu A%Et TQAEdt XtcuS/ut xtsuB/]PPSSm P> PLMse[^]UB"wP4RhH5á`U]H`U]HUWVSà ۉUAEttA AM ANCљ@F j ~u!QQvhFEN)EE j j EO`1@u CjsE+F9|R%RPvde[^_]US˃j 4ً]1ҸPU‰VSA AM~e1[^]*A`@t.q ) Cu C 0 PF;s |VV%Pse[^]UWVS˃ A )yA uAM~ C)e[1^_]C`1@u Fj@9|UWW%Ps7e[^_]U`@t j ËH U5 5 hhWá`UH,t]]UME tA@:tt 1]UVu S]@At8t9vuC;t؉1[^]U1U@<u]UMS] 9  9J49r09s     9s 1=[]U1҉VMSu] 2B9|[^]UWVu S]SuPZYt 9us ً}Etٍ|=!EEe[^_]UWVS˃ AQ Q @)P2PR{ K S))ЃNS~ N))΍e[1^_]UWV1S˃ F<>uS;K 9uFPWK Q #BC )RPPVWC C P{K s>MK ~ 1ҸS)ȃN~N)1e[^_]u)e[^_]UVuS]SVZYمu E IBB=!ƍe[^]U1U S]<@uPRS=؋]U 4VơSi@)i@PP Q4VP@e[^]UWVSX]juE`@PPSh}u 5C^w$`@u S  u;u tF؃ t u`@u j  1uE4]ԉủE܍` E1U@<uE1@U <u@E~=?E@~E?Ƃ@u Eu؉EMM^_EZ}EH$ i54ME EE< tEt <=tB< uU19UEB<=tEфt< uEU}؉ӍLK~I< u)RPVE )ju x6uM)މNt# j +Y[juf}x E؋U=MEM;EЍM+EE;EM̸}M̸EPuu]EًU uى*UE9e@)UPRuEЃ +EM?EM=/}yuu XZ"EuP^_t E؋UEEuMPuU1Y[@<uW}EuuPU_Zt E؋UMEPuE Pu|U1[^@<uEЍM1҉EX}t/}uJ}t}u<EM;EuC}~=]̸dٸ E ^wEMEEE% Et  j }EuU@EE< tEЋU@)UPRu }t&E;E}E 1 u 1ۃ uu؃e[^_]UWVSE;0uSBw xu  1EBw JЃ v Bt)w$J1)9w$CE<빃}u #1EE 8Z[^_]UVuStZwuF[^]ÐUWV1Sà E衰 E EM12yu%QA9wr9wA Q9r w9vGÉ֍A;MrɅuv+E [^_]UWVS1ۃ8j$ $ `  e ƣ WWSVv҉t У FɉuЃ= 11 5 1  E-~u VF tFV9w r9sӍF;ur΁ Ёt << t   O    H0 , DH \`   5  QQEPWyuiRhjh FEFEfFEFEF 1fT0 f fut G)؉ u  f=$ t IJ $ f=$  t   ܲ PPEPR` uEu ز  ز e[^_]Ð U tV u:$v; ز u)u$%=t=wtx1 ]U1ku@ ~= u=u UE;$ y ]Ã=Uukt]]US` U(,0 :(4zJXMZ,)hEf EEuc=ز ttJuBBdEBEdu zB}ucu:=ز t.BExdt cuز =t*RRhEP},t-=a]<)u0<,  0CE,A 0SB< =A0 PPh EP =E 8,u@E]B<wCa ȣ C%B<w!A0ƒa CEE8)u$=0uܲ 0 1t&tE@E8u ( 1]U=ui h] tkRRh h1= u h QQPhAU=u u\sUS ]hoMS+t_PPhStK=t,=uCBu!BCt:tQQSh]]UVuS] uVPP4~Pjjh Vj un4UtUtUt Uu4Qhu~PX4Z~PjSh VjC t1#15 ); u  e[^]UWVS } = ]tAPP55<t'PPSWu5 55<E 8141'PE SP5tF9|ոe[^_]UWVS ȃ} `ME9t2SSh Pu͋U  ȉM} x E ; r1k M= ~Ev E~}E Mu 4}))։MMU;5 UAEE|E;}~EU ؉EEQQSPRh uj; th= u Q;}*4VVPWu h uj t 4EE5 = u} u}4UtUtUt UuSuO~ SPPR0QQPjjh ujF t uM+u;u~ut] +]9RS)uu Ѓ~7E @RjPXщ؃+=   9wSWjPуQVuu;)u}~EuE E=P1= RVuu 뭍e[^_]US` =$tz4 ~Phj5 R 1҅4¾ xB49r11ҡ4AƄ| u$ ܲ t=HH!` y +E ‰ȃ ‹]UWVS F @=uFF Fvhj0v FfUuiNug11ۊ <t<tA0|} u hyt~duF)@2} u! h$v  jd 9UĊB<,uPPQRYDž>/} u hoXu_j 됃 u8 VH8/uVV5XS=uS 5n/CYu=t C X=uHM= U 4 Йt+e[^_]UWVS,E Eܡ48<UU܉M_P U*EMԈىU@9ur w9r_0]#]@#_LE%҉ƉxoU#U);] ~] u4SRd t1Ve])]  ]} t= =tEEe[^_]À=UVSx = tz [viuo_NC9 r04Ph Sj腺t4\TtF1xu1e[^]UWVSL4ǁEwx\TuؙMU-ؙG!GEUșMUċEPؙhRO`ЙËGOd]u t1SpUt PtI4%=u]A$ t 0 MEE8/t4B Bt%=@uUUE̋E̊Et PPu}/u؋UEE܋ 4Eܙ;r+w;r!= U#8UHPEE҉EU4} U(׋EԁOP@9rw9r U싊08!@#OLEUPEQjdE t1P茷uUӋË4U;s}/E˃= tK}tEE8tRRCPu ~أ  CP;oPPCPu܏V= t }CE̊UӈE1e[^_]ÐU4.RhjP茶UWVS54 .F(ɋ~E@~L 9s@))<ˉ)ËEH ~$E1))Ӏ}t9 @-@1Ɂ@;E ~U EɉME4ȋMM,U)y}uRS16貵VE U4M;$.rċEe[^_]U=x = t = u74PhjjHt41UWVS}Z4f .(..Phj(.Ĵ4 @.EuG?/tFt/t P$tU:= t^Ut P"zt&u 5$ x@tNEM9/tFEt Pyu}/u48JtKB&BdXzeTPRRjP 4B2DXā9uD PPjRd4@ֆ)‰X 1 t1ң< 4āQf9t f9u(A fQĆ)УXģ8 A\ TEËU:t WWSRn~ t$}/t~ډ  Se.u*MU uUMĊE׉u}ĉuȉ}E){= x+E1e[^_]Ë U$  ] $  áU]  y y  4UWVS]jDjdPDž Dž$SdIu9duE1{uG0tA'w(-^|W<P>I^B t$ t^ tu' A 9 ~0H (= N~ j '$  ]]{ZvŻ+UVS1+Zx 1ۈ @ uC' = vf= [ ~7  182u 3S B BPh <@uу~Ff  1f9 "u-$Q B BPh h h@uá e[^]U t ɉUS1t R HPh h  Rh؋]ÐUVS1҉CutCuB9|[^]hAA A  UA4]lUWVS1ۃ E Cj-\aCu j Ha+  j 7a1ɉDRPSCh@`b;]|1ۃ Cj-aCu j `e[^_]UWVSӃ `@$t jЃt`@$t jЃSSWjb$ `t"Hu Ijp`߃ FP j CY`J~QQWjJ\b`@$t jЃe[^_]UWVS˃$u EEUEE@EPjMbt j j _ډ1u1"1҉9}C;u{GF;}|VVEEPjMa;t j j ~_EEEJE e[^_]taUWVSLEUM1dEEE`@tPPjun` EM } =y=U=t hH`^@t'^=u\=xU;Et=t XU1ɋEU rWSPhl_uwLc jmc`@tMUċE@$t jЃQ1Qjj `$] Ch]Iu h]XZjj_ h]Y_VjK_$]XZSCj_uȃ 0hf] ChU]Iu h@]`@$t jЃPjjh]^= u= t hΫ}t h= h!^`@tPPu h^WMĺ Wuu }S=t=S;Etu=tn`@tVRu h ]-QQjjI^XZ5hGg]_XE PjJ'^ ][y =\`@tVVu h][=xc`@t j [ SSjj]$\` @uE QQPjJw]t^uY`@t} 4M ,} ~$U1ɋEU =1҉E *M _}MtvuwUU B;E}i`@tE } @E11҉E E U 1ɋEUE Eă 9E~tERum yGEE yE E/uGE U MčD ;E|E !‹EU)HE RMĸR uu }t'  EgoÃdt u O0`@uU1ɋEU 1҉E t!} ~ `@tE >E6]1] EOu$PE)PVFP_ FEES}~ME1ɍSCPE)PS)Vy_1MM)]9M )E }tEă 9)Eġ`@t) hiZMUċEI$jYPMĺ Puu tbu ]]/EEȃ= 5 p`@t hY PPjjDZ j j]S_$j*jSh` F PWu>uP5$ 5 EP\:uLC CPVu;t1ɊBAu  L h#XQWWe Mċ] }tE^]EE1ɋ]IE11UȊGCu}t A<u[ j!V u$jh` VhNܲ ?_ q1ۋM Cuu  FPE+E)PEPEP\ S)Vu\]Bc$}aU EU?U1ɉEȋ]ȊABu}t<uu?QQhZVk[9tp@ PTtÀ;Cuƀ>u~;uFt PTuFt3 PTtt PjTEu EFt P@TuERRVPE"]Y$:T$jhuha}]  VZ_uЉZM̃ U)Ǎ9})RP>EP[}t ]QWuЍPZEUEEȉU!qKE3Y jzY`C4t`EE}tU1ɋEU RRPho h,U}uUĹEU EȋEE PPuuSt; x2 @ M < [ L`C0tЅu `U1ɿOEU HC1WWjPEe[^_]UWVSH4h@ E9E]܃= h}{4EEEǁ`E W7R@t\}~EUEE@EĉEEE EȉEEĉEVVWjPÊ CEU܈ EuEH}]u%t;SSWjPZYjPV`CEU EuE11YEPPjEPt~t~E< t< uE t} uKU\}t uE륅u#t t t대 wCn}~EUEE EȉEEĉEEUEUEEWuu@EEP WEE= ExT1ۋ x4;E|))VKR  RPVC~= y   ;E|A x-  B  < y   b`@0tЋ]uQQju QERRU5 MQM1 E K#U W} VS]C<\t!<^A<wC^CB< w"1ŠC0 ƍB< vKAetJ)EtC0ts:ti,uq]^tSbt:\u`Brt$ ft,nuMst%tuA9 4 / *%  \^, :A9[ ^_]U Vu S]C;0/}m tSxr~buh8+ *}L%%- ]t= A|F[~1&a|:{~%}u0\Ae\AsE\A\A7BA^A0AЃ0AB0\A9B [^]U hhuSU huhSUh$~NUhx$aNUhPu$DNU uu h(RENUS]SRPSY]US]SRPS5]Uu ] @ É¡ U$  @ ]á U~H<$  t  1]Ë U~!J<$  u u]UWVGSƃUM%EEEEERd'c}1.t1#tF-tR uX?:t?X st xtou= C[.FC}u UE1IE#6 1FE2}t(-A< wk TЁ'~E CFEt }Q}tE_1%E}uU1;E}EU[^_]USRP  PI  $}P؋] UWVS\u r VGP=EXPj$1jEP9RE:%B M%Š4<<<+<*<&<'t <>fF`<%PF MuƊ!<]9$% ]ى¸ f  PM1ɉ¸,ED PM  Sh  PAF  $Mأ F1T̅t( z$  @ `DFC<wӉ 9C<.Ӊ FB<w‹ rB<‹ XF1 k ҍ\ЊQAB< vΉ#|uib)VOB;1Ʌt$1҅t94 tu1u 1҅t|!l \1L9-9{9 o`3}uE}u{Ev;uhF1(<%u#Ft Fg ƀ  1Ee[^_]ÐU]    U`@ t1U1]U]U]Ã= Uu= t 1]UWVS=  MU1҉ 9rH1%EB UUEEUE1E[^_]U1]Uh EPQt % 0ɉU1=u0&t PPhEPQQU EPEP1QtU4Q4RhD1҃ɉUS]= tPPSh.XD} u =t gEB9u9u/zt fBXf]US]= tPPSh.C} u }t ]U=t h3 (nhSJC1U tP4  P2 P0 P. P, P& 5( P$ PhrB0 hIB1U= t hl   hB1U WVS 5 } 29u} u  u7  u$=  ulFV)RQh` t8= EuElF)QHP)ڍFPRuhA %= ulFQ)RPhA  } ~58 ulFE )E Pu WQhDzkA =  E e[^_]Uuu uhӲ-AUSEE8tPPEPEPMPjh޲SE$,Ot hJffw%SPPh$%QPPh$@PPPP,O%=Ut 9<wD$8/D(I!Vho |QQP P PRPh? }u7ff$Ut9tPPRhp?1҃ 1U܋]Uu!Qt jh1҃ɉUuPt jh1҃ɉUuh>|=<UWVS<E8uQQEPEP&KRjh޲SC$*Ot hffwPPPh:>1҃bPPPuM*Ou%=t PPuh޳빋E @P*Ot PPuh떋fv#  DžlDž711ك苍 B;|ዅ9|F;|;@u 1; j)1҃Ot3e[^_]U3Uu( %d# h(nz9u')Sҍ R& $ RPm=1 f $ 1e[^_]US1ۃLPPEPEPDtWU1 ; t&@9|u Ct:PPuj5EE8u  t  1 1]UWVSuj65NjE8t?u uD<$D 4XuM^EV$ VjPEb9؉uXH W^$ 9t WPuVh6 H^MSSjQMhbujHBcH11EM 8tQQWPuPSh>~6 C9|1e[^_]US];u1S>=llt_XPjhl>S4u l7PjhS>S3uS>ll>PPRhm51]UWVSu,>)TE|EEEPhjSË]EԐ}EܢE䲵Eɵ;WWVj24${BDž \S9 PSV2u2 >PY[Pt;t.u>ht ,u P Sy$$^ZPhߵ[4<$Y[PhF4T$_ZPh+4|$[^Ph 4E$ZYPh$31e[^_]UWHVIS1ۃ E@tQQPu/2u4DtRRPu2u mu1e[^_]UWVJS 1ۉE@tQQPu1u4DtRRPu1u nu1e[^_]Uh;ub1u$ 1PPh EPY?UWVS,`]EEEEERjhASo0u MPj hHSQ0u MPj hRS30u MPj h\S0u!C EPPEPEP>uaPjhgS/u+CEPPEPEPb>m}!WjhpS/uEVVSjG/EE;uO `yAulFulFulF VSR1h711 Q1Q1Sj.$E\>E=R8RPSm/u$}yU܉Uȃu!E܃8uUMܺ] E؀;jM҅UhB&=tEt y|F8u &9tX=tQ1}t*5Et h5`0G8>uӋẸ`E߅~HE}t11k8ukE8U`PUtd @dM9 `t.-QQujHEXZEPEP. Vhjj58 ]E; vEP؍MUE]EMԍUHSn ƄE܈E䈄EEEЈE؈EԈE쉄E艄Vj5fEU 76 e[^_]UVuS V$á( t rwwr[ 4T9v VPCPVQ1%XZ5 Vh)t5 0@أ $ VT(1҃e[^]Uu u4U( w u'UVSTj$j]S% jhsSQ$1ɃЃ?wD AuD $uQj jV|%]$j*jVh(&jSVV"XZShe1[^]UEMU tHu! U M] EU M] "]UW1VS0ujhǷVSuPfPVjSjhͷV+uQQVjE tF jj*j]ShEL%V@+ WVS21҅tp b V="=~<4RSVP " ) PjS$1҃=$ e[^_]UGɅUW1VS ]PjhзS'WjhطS Vjh߷SQjhStpRfjhSt\PfjhStCPj hSuf(aPjhSftPPSj S 4  =_~;PFPSR0!jW5 S,& ( t 0@ e[^_]UWVS\=4]EEUERj ShluPPSjE0Pj ShBu C EPPSjXuz(PPSjE8duPPVjEQQVjYZPjEEXZEhP_'uUUPPujQEЃ SBVPPhWF4$@,< uhjj[E EPEj;UPGP0]tEVjFPP f>yfUjuYL_+ u$AEi }Eġ UEuUĉUE9Et hVUۈW@E؈EGAtfGKQQh5kD=EURRhPED=UEfzujExÃ=u%` UȉWDfGBfGH;;|xxf8 wfxu@8uE hE)EY^jjPCuFuUEPUЀ:pu3UۉPtRjEPVEQQujAEЋEЀ8RRPu:Xu$uPPuV u)u!` ]ܲ  U9u Qj  EEPV XZFSP[^ujYuL> hF(XZkhu=B=C.(Ext9U؋EP;tƒBuVVSR} QQh5uguRjhPqt S-Shju=t Sry SWRPu+ jP,F+ }PPh5uuPhj5=uShju=t S SSUċE i6taPU5)Uju$+tCPEu)Eju +t(UE 6tPWjj*}t% Ebe[^_]UWVS$]54Sj$e;PPjVf?m%= Wv%=ȉә= 5{ ShjjP_* Jf}Ut311ҀtH9 Au݃ Phjj5) PjhPPjhP}uHE4ktPPVEP҃u  e ]W+  VP(t5QQVh + VShh@ 1 "e[^_]UWVSЃ U_PVhSSEY^ShǸXZwS=u'h@ uh߸7\$c hO1e[^_]UW1VSE jP]hP4LdP` Dž<Dž@4ܲ 8Pj ShuPPSj`Dž<Vj Sh uQQSj3{ <$Rj ShVuPPSj$@lPPSj $"=J, 0>t V!=t` ܲ  $`  (ܲ w1]uXhhh߸St uSh"h"h߸SB hWh߸S% 5hWh߸tS 4h(Wh߸P ƅ}k1ۋPPdV2 hWh߸S , ,0Lu $(wtSPP4VP($t%TSPh߸V LS C ,LlF0$9,t@uDž@lFlF<3ulFPP4PtPTPSEPQ@TRh@S1 (ShY6 $_` (ܲ XPS9u hs hd 4` 8ܲ e[^_]U$u=4tR5E Pe u E <^w E P j?4 PPjEP8u1ɉUWVS ujhV, EuWWVj EE1>Pt|}u tq p U&~&1 @ CPu 9| Cj a &~}u j I 1}EGl} j  SSVj4$EE@QQ0V)UxRp 0h \ WXB~GAB8 tHKu h E GPe E9]| j P ?uEUIu>e1[^_]UWVS Ft8u I V$4$,PPh Su$\PPESP@t%PPjEP0uك S@u뷃 Sz1ҍe[^]UWVS o@t h4RRj~PRu4~t hdP5 5 h>J @th5  h}E!A~ɺtԺVF ^NPP1QQ1Whݺ 409ue1[^_]US]StPPPSjTÉ$;t S2"uQQS5P1҃]US=( t`@4t `( B$P5 5 Rf f$ fuw4ƣ` f $ ft 9tAu h$ P j4`  5  4|PjcPPh 5ܴ %` 1]ÐUME @t t t t=u@ t tt=t]US]hu h{ u hEƺ] = U` hܲ   t @](UWVS uFt t t=uRR0uu| u1e[^_]UWVS 4u=t;=  hXGu)QPVu E 8u=( RjhnP u uSSVhJE@uQQVh5Cu&u jjPS1e[^_]US h@ 1} $EX jjhuh uhE8tà Pt@u 럃=lt hujjPSh`]ÐUWVS$d Eܡ` 5h =l EE؉EЋME܋@UЉ!! ‹EE}Ѓ@ڃ}u]1Eމlj릉]։É!#E  ЋUM܃GDEU؃u]׉1EE U11؍M܃FHEEu ]ƉӉ1]lj뭉]։ˉM 3UkGLƒ UuU d Mh  l ` $[^_]UWVS p ƒ?p ? QWVP?@)R)SVPO   @@?PSVh !e[^_]U@Sp ?ƃ C)Pj PP8~ Sj@jh /p    k]` UWVS8] u}E؍CEt. SPPhuuj+u,PPhuuQt +u܃~U2$Pjhph` U؋Ep ZE܉PU؋EE jPEP jhph` U؋Ep ؍V]؃EڍE]غ#EE21ۉEWjuȍEP4 jhph`  كp MtU؋EE\؉љt E܉B؉љt U؋E'}t EU؋E CEL}܍\71tV Eȋ} D E }t= ȃ?E̊:uu ȃ?C}tMFu}fO }t= ʃ?:u+ ȃ?CtN˃}ue[^_]UWVSl} Eܴ ط@u 1 t-}Cu ^auTbuJcu@du@6Du )guπhumuru suvuAt tA\}E4 H9v8/u8/u@EEEEPPEPVU܃EJ‹EH%‰Fuơ`  EHEEɡ E̡ Et E  EEEQQEPjjjWSܴ 1 t   RR5 5 PjWSUdUWVS uPPj5 "u  u  ):=7v 8)PW`5 4P WShP4r1=e[^_]US u% 1҅PPj5 "u 1nPS5 hv: E A  ǂ       ]UWVSX uGPPh PK!tF=umEtu`)ك ~W:uOBB=ORuBBt~3t/~*ft0 DžqCE]9|*DžDžEWWhP@t }JDžDžDž4NF1L!Ѐ!Ѐ!Ѐ!f!f!Ѓ!fE…u %ܴ =ܴ w tft9r  t$111DžDž}111DžDžDžDž ]Cܴ C S )‹E)P{u $ CC= {uCS CsK9r9v 9r);Uv   DžDž))ϾDžDžDž эvE t=t5ȉ% tt t 5Džܴ % ܴ u$u DžDžU% fu DžDžDž:DžDžDž= t%=t %  u1Ƀ Q= RLfU@HdrSf 4ƅq - 9У0v0fvfDž fv0LfDž?fDž fDž/41fDž?fDž Dž 0Džt ɉ$  )-4,u:40)9v hR 0 49vtSPhY^h,u RRPhvE EXPPuhE E9PPuh1 EPPEPEPEfPPh5u ~VVh EEPt#uk 8iE Pktmt1Ƀgu1 1 H  9~  8*      wSVP5,+Qh P5,pXZP, PHdrSu fw+P?+ Pj@ ,P}SSu j,fҁAC,9suQQh5u uWEuQfwF,S9s5 CCmCeCmC=R RjuPKX V,[^ 4P=}tt}}( <11Dž1DžDžDž=t "ME QR% ǣ h:         ulFDSP5 hNX Z4SPT9  ut%  hkkPPhoV [^4P;t=u   =G 4QWjPwXZ= Wh{=t!= $ + 9 t%  4  WW hD Y^4P;uzRR j EPuZ M4  EWW PhE Y^u4P\U 9t@ h    Dž  EDžDžU; sCw s s 454{9s uܴ K9r99s )򉕼;v>9 s )PSVh[XZWVt>PPSV9u.9vW3jPEM9=u    t %  " Y^4SP95 RRPh5  MEk( y uuytoA  !‰ qkE(_\0XS5 ytH 4QQSP9؉u+ kU(D2  EE; m149 rtD h       =u+RR5ܴ h&t$ܴ  j Dž}tO9EtD DžoPP5ܴ h룋e[^_]Uh=y!PEPhjUhU Euhh2hh(EQPRjthh3hhE%=`UjQRPUWVS u%=t U EuhhHhhSSPSt41э\QQhS)uRRhSPj h%SntYPj h/SYtDPj h=SDt/Pj hJS/tPjhVSlFu$L1%@PRh_LQ{_XjSy 3E j։ɉd9u9t 1E]V SuW49t W1 We[^_]UVSuDt PCuue[^]UQRPhd5 Uu uEEhv5 uu5USU:tvPPhrMRst^ P jh1SPqy>ShjP=t S1 S1]UWVS]Cd@u8PUPE j4dyhh!hhCPEPh`d E C h EPhdut*DžpDžtDžlDžh(MUDžtpMlhd 1j1yWW5hOQhVd*=RhVPi}Uu}tPP5hDž|11DžxDž``zt*BR@?t19u9t Džx|`|u xuDu*>v 0 Ph5tKC 1҉slShKp{uv;uq{uk}ylCC?PCCPEPdjuUE t  CCC {u de[^_]UWVSl}uhh hhE8thh hh hU1҅uAhhhhʹE 1vW蹄Mu} PPhrMu #iu16OG#A]FEu)ӉDP uր(裿BDž1DžaPuhIVG4$teM VU8uhho,tVh>idDž0P}hSW蘺<$IteM WKU0uhh}tWh>P8dDžaW}hdW<$teM W蜿U0uhhtWh>衽q5_WMЍuhnQE4$tqE UЋRM0uhhtuVh>G ^DžaS}h}W耸<$1teE W3U0uhhetWh>8i_WMЍuhQܷ4$tqE UЋR膽M0uhhtuVh>腻G^4(WEhP%UЉ$t{M EЋP̼U0uhhhh(`tMQh>GTu~tw ._QQ5hXZh u 舷#Dž1Dž1Dž1e[^_]ÐUf;A,|f;A.t ]f1f]É'U‰SÃfH @ufC1[]C{fCtD$$?͍t&UU Eu]ɉUƒ} ։}xt]P%ۉEu/}0! ! E 0 ȋ]u}]Ðt&mMutHƅuՉ 0 뼍&'UWVSڃ\U$E@u Ex1MWwME} fEUUGہ}ue}0!؁ E! U0 E@ O(Af9}1fqGV9=fW1\[^_]҉u덐A9~ˋfqGV9~Ǎt&\[^_]Ð}5]WDžu U0 R&fqfqfvǵDX@7 Ofu u.]fYMЉGʃ9fWE]:uW_ Ɖ%fM։E߃ UЉ]؉EU؋Gہ}t ҉ũ}0!؁ E! 0 E֍@ O(Af9EA9EEfA  fg fEEfGEf1}3NjWu U0 ^]fYfY1Ȫ fUщf)Uuf;w.tEf;GU0҃ UfS G9fWf9M;Eы_%]ĉE˃} fM‰EMċG}t ɉu܃}0! E! M0 E@_(Cft9<C94fS+fSfS}h]ċODžu M0 딉Nb<$U7tD$<$Y:fRfg fM<$BUfO @fEGfED$<$9fEEO> Uuu]u]u]ËU t^F4$b1^А&US]u []ËU Mt$b1ߍUEU ]!US]$NtC[]ÐU]]u}tK S@t!f;C|]u}]ffK f;Csf9֘{@C(Hftf9}fPfpҍ ֍9w 99s$a1됐 Uǀ1]Ív' Uǀ1]ÐU t#ǀ$)y$.ɸÐUWVS}txGwuU_(EE]EU G9w ȉ09sfCGEE fCG ;E}fg ffG<$`1[^_]ÐUD$D$$UWVS}E eU1҅Xu Ue3= Ĭ[^_]Ë tff;ty<$KG t f;‹\x@fBff;X1HG :But $q<$YK{G tKG$fO f Dž\ff;‹txf<Bff;t)G u#t w D$<$T LEuU X0 f;‹txf Bff;f[O*tt&t\ $m Yl`ff9t|x}f9xftxBf8Cut&:C[uG fG &fx" xhƅhD$D$$jh ‹ ffǁTxf=ff;f t&f{ Aftf;7`e fǁifBff;fZfǁf;*fǁfffǁf;fǁfǁ $\  $Afǁfǁ'fǁ~kdd *zvBviD$t$<$o @v$ K4$n9s$K9r f;‹\xfBff;oX13\4$ K X01 f X2<$,fffǁf;AxD$$D$$ fǁfǁfǁfBff;ffBff;fEfx"S xhƅhD$D$$褥h ‹ ffǁTxWf=8ff;uC t$&u}$&  vWt&t&xt&hE9dXLE9ExE)9EwE}E4t$$fUS @t{tCf9EfS $j%t&}f;Cfc f;CfC}f$*% 1}E1}1}E$BU1!a9}#ED$ED$M؋U<$rE葡{!D$ $j 9}t&uU؋Mt$<$T$U 9ljErfc D$ $ZMD$L$Tf;dE!MMUS= t []Ðt& $t78t2$D$D$(t []Ít&ǡ\$ D$D$$$訡UUSM] u[]Í&xB9|fxB9B fJf࿃ fB 1ÐU B@pt$ BP t( @D$$D$$ ǀǀtǀ$褼fU@BWVSM1= ]ۇE]$su߀{$ts[>萜 ,Ã0P$>tzDAuր*t[.u>tDAtƒ0P$5,]E}EE fEm]mE[^_]ÃE ɀ>uu ,E]؍^fUST$$=@Bt T []Ít&UWVS @$賘$蛛X   ~_Ɖ?D$A@$ D$ @@0$ D$ @@H$$0 ǃ@Bǃ@B D$@@8$W D$ @@D$0 D$ @@,$  D$ @@L$  D$ @@|$\ D$ @$ `A ǃdt"D$$X d QB(|hD$D$h$D$$ D$ @$D$$ D$ @$pD$$ D$ @$6D$$V D$ @$D$$ D$ @@ $D$$  D$ @$D$$$  @@(  @@,  @40  @@Tt4  @P 8Ax ǃ,D$A$< D$ @$Z@ D$ @$&D D$ D$ @$`H D$D$h$,P D$ @@ $L D$ @$Q PTL9~ȋT9~ȋ5 X^t.Cpt'T$$tFǃǀ [^_]j   ǃǃB<| D$ @$ D$ @$j 'UWVSE|eU1҉<${L$9u CU$T$ $D$G= 9u $C})t= ;Cp,t*> B= 9Y@B|9M DžBBB  C@ } $|$$ÍD$\$$g |9M   `Cu )΅t ;C@DD$L$<$ C fxC|Džu C @Ɖ)9u |eC= $u;\$<$c@Bj= u +|~;}{Cv @xD<$ݑ;s6~<19t%|$$9uאt&Dž@B9~8|$$`T$$@B}e3=Č[^_]Ë 9uDž@BrC+}t ;CpL  9L$$4$;BsE1Dž9t$ $uf@B |9M Dž@BC|+} t ;C@8pD$T$ $0 C fx?|CDž8u Dž~ C HȉU 9|g= C04$;t$$j@BN = +M Cp84$胎;s8~819t#t$$uٍvDž@B9L$<$T$$DžT$ $4$觍;Be~1Dž;>t$ $u= Dž= Dž$t$$ÍD$\$$ $|$|$Ë$\$$< $L$a|$Ë$]\$$ $|$"$ÍD$\$$@ 2= = Dž@B = Dž@BM1ۍIt|0Gd@(v09t9uꋍ1= Gdt@(89BuB )v  "    =  =:ыt&UWVSL eE1u}y9A9E@Y9] |cE t&A9[9ljFUt$T$h$D$<$ÍD$%\$$Dž@B tL} tF}A9E+1)‹E+E 1)ƒ~[t&@B 009t$'4؋]e3L[^_]ÃÄPDž B@0tPD$<$6U1D$4$T$1=@Bt 9> B@Ht\ @D$<$XU1D$4$T$=@Bt 9 E 1ۅ~ B8vxl^BH8P @D$<$UD$4$T$=@B 9D$T$<$E ~ @@<$D$h @@8<$D$Q UHT$D$4$V{t&9ljUÉljU} D$<$UM D$4$T$=@Bk9_DžTf B@LD$<$]1ɋD$4$\$m=@B 9 Dž @xF$0 Y9] N+D$\$<$$H&$1D$D$ EU19U ZU ƉA9 @@$ $t# @u$ u݋ E ) Dž. Dž\)]UM D$4$T$n @@<$D$]1ɋD$4$\$1\ @@0<$D$uE11D$4$D$# @@H<$D$< 1ɋ]PD$\$4$$ wt&t&'U D$ @D$$D$ t $ @t$$ .ÐU] Ít&U] Ít&UWVSlEeU1ҋ]} 5\ E$ݬ$`Ax<$,~U$1ۉT$D$+  t$ D$ Ī |$D$ $9 t @ fx~ t&E $}U$}$ʞ 1ҋ5 C400`Sdžl~ 1ҋ5 CFlt tD$ $‹C1ҋt tD$ $ˆW72tv$2 $؋Ue3l[^_]Íp1zX PhUPlUPpUPtUPxUċP|UȋŰUЋUԋU؋U܋UU䋐U苀eEEe?e$U PhUPlUPpUPtUĉPxUȉP|ỦUЉUԉU؉U܉UU䉐U艐U쉐oS,҃Ī D$ $21r 1& Uǀ1]Ív' Uǀ1]ÐUWVS,Eu ,[^_]ËE@ uP p@fU BAB $* }ZGUUfg fE)9MfyAH,}fuf;wƋW(@EЋA(UfEEԋMQf}A}9~E9EM1}?fM BEEЉ} EfPt&U9E|@}U;t܋}ЉGftf9}f9W}fWfWfW믋Mԋ}fEEfAfAf9G|U؃ E fEMf9BMyu>Ext}UGB12‹MfBfBHfBfB fAˋ}AGf+]f]afUS]t,; t*$u{t @zC[]C[]yUWVSlt$,lt$lt$lt$kt$kG$-GtWt $kui<$k;= t [^_]Ëi   ȭ ĭ   [^_]1i8 uG$Ak뀍vUSE  @$Ї B` Bd Bh tȭ |ĭ ؃[]ÐUVS t t [^]D$D$4$tFD$4$D$D$D$4$ fz ~1ۃ؉\$D$ B@D$4$D$ B 9 [^]ÐU t+@  @ɸÉ'U t1Rt $i $i ǀɸÍvU1҉Xuu }}] t]Ћu}]D$$htΡ  Eċ@ @BB BEċP BffA fzBfB\ fA1K Uȍ9~1Ƀ} f{fKjfaD$$6gCC JfzMtME MU؋@T$D$$ g M؋]XL$$ C UM؋@DL$D$$f UM̋@DL$D$ $f P@ ;EED  EB;E~zEZU؉E$T$f~]u}]+B B1=\ 1=\ D@\ U̍R)ƃ uEfz ~V1E)Et7B 9~.EEEER΋EuUDuUU7  x\ 1\ B E)ƃufz ~1E-Et>B 9bEEEԉEREUMUD uUUB E)ƃu~lfx  @1M@E@ 9EыPLUM̃t̺EE닐UWVSà S҉E~c1DSz t! A @f~y}s9CD8 S9~;uC|8 u9 B fx~{Bp$讱[^_]ÍJ1U}L$!‰T$C$6 tCt9@S0BD$CD$D$ S@B S͋Bt$[^_]ËBt$D$AL$m$U uËt1zuQ @$kÉ'U uËt1zu @$ÐUUM t#B9|xB(I]f|Ív]É'USEt,Xx$@(1fxtB fu 9~[1][]ÍU $]t$U |$Etxy$t$|$]{949}FRC("&f@S9ft 9|Uu޺f@1또U8}]ÉuD$D$<$h`$ _t `hD$D$$ auht"9tu t&t1]u}]D$|$$`؍t&US]= u.tx D$D$` $z`= uu[]ú443 []ÐD$` D$ $ `D$` D$$_uJ` uA$ ] D$D$ $ 4_  fUE]鰋U uu] t $< Uft;ft[fu+fǁf;t,EDx1]Ãff;ufǁɍfǁf=t*ff;tffǁfǁڐ U@xdHhҁ@tHlt Hxtttttt t]Ív'UWVS< ]EEE00  @ fx~b@Ef~E싺11E&!Ãt( tt9uN΃]ufu } @ @fЉ% %? {E!ˋ5 9)}ljEt؁!ǀ}tEu }0J @t3 @t!U D$$T$Ҥ% 5 t7 H U D$$T$葤% }tAM] 9M[UE T$D$ U $T$'&}t   É<1[^_]!;]W EEEyEnEi ց!ދ@   D$$D$ D$D$D$D$D$ D$D$$ސq}}t UU9΅U9E T$D$ $D$  t t9t-t#U D$$T$Y t  @x <1[^_]@ t tAt5 @t#U D$$T$赡 t t7t/ @tU D$$T$kt9 @t'U D$$T$>؁% 0 ƀ}tT}u}tG 9M)}tU9tE T$D$ U $T$@t& @@dtU D$$T$覠t& @@htU D$$T$x t& @@ltU D$$T$Jt& @@xtU D$$T$t) @tU D$$T$t) @tU D$$T$躟t) @tU D$$T$艟t) @tU D$$T$X @U D$$T$ U D$$T$U&U&UED$$WÐUMU tQ1]Í&UWVSEP8҉UP19~UB8R1E9 N(AExHUF4@AZ(V0 CUft9}fSCft9Vw&fKV[^_]Í&'U]]uu }}u]u}]fC8Et9{0u9s4t|xԅxЋMSAT:9SAT29$C{0s4E~/vS( EH(E  9u1Z'UWVSEEX8$UR҉UMEEA4@C(xt&fxTUu_r(R0))Ӊ!E@9ÉE~Fft9}fNFft9~f^E EE 9Eu[^_]ÍUWV1SUnE@ k@UD$B$ƅ:UBfFfBfFBfFBfFB fF BHfFHB fF BFBFBFBFBFBFBFBFBFBB F0F4FB F8F B$F$B,fF,B.fF.tB$v @ fx 01؅^t& $ҡ  BDt$ Bt$mNE B$эE0@ tSwF<u/u 0҉ 0Ku܉0AD$%$ CAD$%$B߃`փ`n4$ G$  ) ~&'UWVS x@ 0Ҁt <~09t?$W @ fx` 01؅$ҡ  @Dt$[^_]Ë@\I`;$Ë@ 0ҡ @xt <~09t9$o @ fx 01؅c$ҋ  BDt$  B\ ÉE<u0 fx| BD$ BD$D$$c@ 0ҡ @xt <~x09t9$ @ fx 01؅N$ҡ  @Dt$菉 AD$ AD$D$${  QRP(AB[^_]t& <u 0҉  0*փ`0$U j t@w3<uu 0҉ u0AD$%$=(0G E 7AD$%$=AD$%$x=փ`փ`~$; 2$(   &UWVS,5 U xbA9~J 4E܍&x"U܋R(@Uԋ98t8EA9̀}u094$ B fxk 01؅4BPtA+9,bQ%EEu)ډU]uڀ<0u U0҉ ֐t& @xt <~809t:$ @ fx2 01؅$ҡ  @Dt$1 A9}RmM~4 A9t?@U$,[^_]Ë b맍A9u tAD$%$U:,t&փ`$  WUi u$   vUS tC$ @ fx 01؅t tu[]Ã[]cvƂD$ D$D$$ ƂD$ BD$D$$=  fv$ = 2fUWVS,} EE}Us9E „ҋCt1t'19k,[^_]Ë9ÅtԄtD$  ]\$D$$] 0E09$ C fx~ 01D$ut$C$GmD$t$$s G: @x(EuEuuD$ EED$D$$V Jd1#}]u ـ<0u E%0ɉ ޡ @xt <~W09t9 $ @ fxQ 01؅ ‰$ѡ  @Dt$1 B9AJ9LB9PE@Mu0?97D$  ED$D$$輨 E009t5$l @ fx~ 01؅]U1ۡ @$);]ulD$  ]\$D$$ E009t5$ @ fx~ 01؅TE1ۡ @$q~;]u 1,[^_]Ë 9‹s9mD$  ED$D$$ 0E09$ C fx~ 01C$}9D$  ]\$D$$f 0E09$ C fx~ 01C$|' J9E]9]P1SA9E \&BD$%$62 t&΃`$  ɋEP0M *D$  ut$D$$ 0E09$ C fx~ 01uzD$ED$C$fD$UT$$y4$ \$ 뜋 3 y4$ s4$ $4$ 3fUWVS,} EE}Mi 9„ҋAt2t(19}wj,[^_]Ë9}tӄtϋ D$ t$D$$M E009$ A fx~ 01؅~D$ED$A$;eD$UT$$dw @3 @x!EuEuufD$ E+ED$D$$F JT1#}]u ـ<0u E%0ɉ ޡ @xt <~G09t9 $ @ fxA 01؅‰$ѡ  @Dt$!x B90J9<B9@E@Mu0A9}8D$  ]\$D$$諠 E009t5$[ @ fx~ 01؅EE1ۡ @$w;]uj@X D$ t$D$$ E009t5$ @ fx~ 01؅BE1ۡ @@X$iv;]u 1,[^_]Ë 9‹Y9}uD$  ED$D$$ E009$ A fx~ 01؅A$ut&[X9}f D$ t$D$$` E009$ A fx~ 01؅A@X$t7 J9E]9]`1[A9E l&BD$%$6*t&΃`$  ɋE`0] 6D$  ]\$D$$ E009$ A fx~ 01؅uwD$ut$A$^D$t$$"q$ o$ 럋 < $ v$  $$ ?'UWVS E }u BxtI MB fx~ [^_]ÅED$M$L$U  BxuSx t ;ugED$ƉD$ E |$D$ $8t$M <$L$E1[^_];u1ۋ )؃D$ D$D$$Ϛ1Ҹ S9uk HY t 9F9t$M $L$\$;q ǀǀEt$D$M $U 5ËED$D$ @@ $a\$p ǀǀjE)$U ;vEىMD$M$L$U EwN @xtYE1ۍvD$ M   D$D$$1Ҹ ;]ux vE t&눋B@ )D$ D$D$$觘 ]I$Aot$E D$ @@ $Z$o @$o HY lE t" ;U E 9t$M $L$1Z$n ǀǀEt$D$M $U EËED$D$ @@ $Y$Fn ǀǀMT7 $M E"ht& /$mt$E D$ @@ $$Y$m @$m S&UWVS\ U@? ] 4#ÉEȋ<uE u0 ֡ @xt <~!09t9$ @ fx 01؅$ҡ  @Dt$Kl A9}Im}7G;w A9t@0A9uԉ 놋AD$%$!>փ`$H  0 7A9@ < 0҉ @x09t9$ @ fx& 01؅ao$ҡ  @Dt$fj A9>1\[^_]Ä8 0ҋ@x<<~2փ`09)]f}dGE9tQvM;u EU9Uu Ct DP9ECt U;HEE?E 4A9j@F8'ÉEЋ<u0 ֡ @xt <~609t9$ @ fx. 01؅$ҡ  @Dt$Qh A9PEE9EU)UE<=\1[^_]ËCx4&=-ԅED$ED$$訏f}u f} QE9ЋEEÀ}0҉EċU؋09ЉEt7$) C fx~ 03EUĉ%ED$T$C$dRD$MĉL$$d E}A9@tt }* @xt ~=09]tV EUB9E1 }̉MzD$ ut$}D$$~  @xt H 1a 1@$D$MUE EtPuDu8]ׅED$ED$$H}f} EMQr9};]M;u5\L&9u9|9T|$ ]\$UD$$}ىt$)<$UE] 5u9]u;uE|$ ML$uD$$R} +U;, Ẻ<$D$MUEE1 ]VߋuF9SO EŰuE]܍ u̍;umt}u;u܉u~U܉U9}49uvEȃED$ UT$MD$$[| A <]E,E+E9UE009tD$˱ A fx~, ‰E01؅t$U A]܋)\$$=\$D$$)P ]9M]; Mу9SA9tE9}؉D$<$MUE5 uX U9ډU}]]ȃ\$ ML$UD$$z;u|/ @M @E+E9M$L$MUEV ]|$ ML$UD$$BzMȉ<$L$MUE E ẼD$ ML$D$$y$ f UT1D$ ut$D$$y 0E09tS$J A fx~( 01t4$ش A@$P 塼 Eủt$E$MUE UȋM+u܍DV ]01 { A@T$tO9u5 uXTU U]U4)%H| \`d+UA9# ]t&f}tz5 uuFD$É$q8˲s@B 8d+Uf}t U* E5 u4$۲ E U Mt @BEUWVS$舟 Eft fM- = G }fx Efx  EEEU]EE[ۉ]&Mu]؋I(MM܋9M싎u]˃0ۉ|!؉EE#EE$ UB pMU؋D:< U}|!;|h< ^S9}؋}9}}}dEUMEԉU;M}>}ԉ؋#;EE4f#B;E)9uE1ɋuE 9uuF fx~%]UC @u 29}}}U|ERE9‰UkMEE A;E, {u ExME  Ax}]uG[vPf]fuUE }GHh UE009tF$ɩ A Mfx~+ 01؅t$T ]uF1@$J= }ULJLJ1fzEU9;ӵ~1ۉ؃19u  EUCBuF9E1}v(}fD2fD2 G9}C9E/UMs(RfD2fD2C 9}Myn @ fxtR t=$M @ fx~" 01؅t$ܭ'F P P$軚Č1[^_]á EUMȋ0ɉM̋09t< $ŧ @ fx 5 u01؅UfzMEMMu]D$ \$D$$uq= W}1]S9MA9 uȋŰ@xt <~M09t=$ͦ @ fx ‰E01؅eE,$ҡ 5 @uDt$cG EUB9 s M]S9uEF;E}D$ D$D$$ p EU11fztEfx~" 1ҋC(Mȋ8 MA9] C9EU97m, ]Gt[t&苯 $5 udž]|}G9EIE܋UuEЉU]C9}~} UЉˋG(}0!;EEЉx+f}˃UЋG(}0!;E#xUB9M1EE A;E]MnU!UMUE|pUɋ]RExT4 uJ}0u;E^Љxހ u"}0u#xuՋUB @E]A{9u< u]ƍtUB< J?;]g 9'u|M|u|D$ D$D$@$op AMx5 uR UJ&B9mE蹶 ]]CD$%$փ`M$ M ]wA fCfCD$ D$D$$lR5 uNx1ۃx胭  rXltiYփ9~E11E A(Mf|0u C(f|0t. E] UB9|B(fD0fD0C9|C(fD0fD0 ;}}s蘬3EZ$[= }= } PEǀǀD$ D$D$$cj ME009t~$5 F ufx= }01؅suD$}FD$G@$> E E M뷋@UǂǂE009tI$Q @ fx M01؅t$٤ ]Ufz~J1ۉ\$D$ D$$ i @@$? B9D$ D$D$$h= }  Ms5 uT$  EUo ]aU$]t$u ~)~% A9t$Ћt$]Ðt&1A19 U‰V1St/ 1Åɉt9Q8t" t&9P8t @Lu[^]ÃӍCUWVS@5 MOUXGfE򡼪 @+E9QUf)fG;]NEM9~9t?9 uM\$<$L$_[^_]Í&+E9t9uv]뭋]뼍;ut]+]됍vUWV1S UM싘t<1C uC81҅t @8u9t'[Lu܄t u1 [^_]ËEM$u뼸ԍt&UWVS5 ^F)‹E UUD$$~;] = FE9E B9} }uto1tc1[Lt;C vu9uEM U$[Luʼn5 u U@ fPfVU ffV@f+EfFt$n5 džt$L ǀE)EUE  Ī 1[^_]ËMEE5 = E F9E U ؋MU 15   5  &U]] uu ƀ\$4$u]1u]Í$D$ $oa] ]uu]UWVSE@(E𡼪 uvLU9V8uB9F4~F4UB9F0~F0E~4HF9~f)fNU^0FJ9~f)fNFEx.U}]1ۍ V(E  9u0vLV[^_]Í'UWVSփ x1ۋ$9u<$ [^_]Ít&UX]]E }}uۉEu]u}]ÃExUxKC9E9EMЉEC Et%K8US4A9UAS09I(M؋UUD$ $AEiMC EE M̉EU1M9M!EUu_9ME9EỦ$e1MC(M9&9UЍ M}ԋCދEC4S0M؍@44E9EMME9E#A9E~UfQEfAEUE 9U1Eu<}cM9M|*UčR4C( $ EM9M}C($MEUf9K,fKC(fS~fK,C.Sf9;ECf9C~fCf9~fo1C EUEUC(щUP@fQfAE9EU9UMfAC(U4멋M̉ $tAS1t&9uEES EU1}QfS.,UE]u}]E11C(0 $9}}U]]uE tD$$t]u]ÉE]u]$O* ΐUS$EE$t5ED$ D$D$$^xU9t :u$[]Ã$[]ÐUWVS  ٺ @A uǃ+ǃ+ǃ+ǃ+ǃ+ǃ+ǃ+ǃ+ǃ-ǃ|ǃ+ǃ~ǃ_ǃ+ǃ:ǃ'ǃ#ǃoǃ<ǃ>ǃvǃ^ǃ#ǃ#ǃ#ǃ-ǃ-ǃ<ǃ>ǃ*ǃ!ǃfa= Glt$3= wtFdtD$${GHtf$%EvV1}E= H~*A @tU싂H0F9Ew[^_]ËwiD$$7U5 ڹBu Jtt u v =uRQ= GǀHǀl@dǀǀ [UU; t#x19@tu] á ]ËD UUx1t&9Dtu]Ë@] U h$ $M tÐUS]t,$yt$$w1; t[] []Ít&'USE  t0$1ң  @t ؃[]Ð UtDPtJTt]1]ËuڋB|t u]1Í Ut4PtJXt]1]Ëuڐ]1ÐU t;D$B($s 1tfǂfǂfǂÍ&'U1]É' UStX@9t[][]Ít& UStX?9t[][]ÐUMU t u A$1]A$1]ÍvUMU tQ1]Í&UUtE B$]Í&' UtEB1]Ít&Ut$1҉$tB 9t t$t$]Ít&S$t$]Ív UEtRl]]1ÍU M t)ɉt @t$-1á @u1ÍUuu] tgxc^9tWtrtWvtlu @@4tK$S- B*؋u]]Í؋u]]á @@@u뼻뇡 @@PuUS]t7 @dt $,) tu%Xu1[]á @`uԍxtu5v @tōv'UMU tˆQ E]dt&]É'US]C=v []á t S1ڐUt$u$E t u1҈V$t$]#uڐ&Ut$u$U tҋ u1F1$t$]Ð+t fס @P tƸUSD eE1] BhۉEBlEBpEċBtEȋBxE̋B|EЋEԋE؋E܋EE䋂E苂E싂EEeE$*uzU PhUPlUĉPpUȉPtỦPxUЉP|UԉU؉U܉UU䉐U艐U쉐UU􉐠Ue3uD[]Ít&MȀQt&t&'UH eE1BhEBlEċBpEȋBtE̋BxEЋB|EԋE؋E܋EE䋂E苂E싂EE􋂠M̀EE$Z)uzU PhUĉPlUȉPpỦPtUЉPxUԉP|U؉U܉UU䉐U艐U쉐UU􉐜UEe3u'UHeE1 uUe3/Ë t݋BhEBlEċBpEȋBtE̋BxEЋB|EԋE؋E܋EE䋂E苂E싂EE􋂠MMEE$'M ǀ UPhUĉPlUȉPpỦPtUЉPxUԉP|U؉U܉UU䉐U艐U쉐UU􉐜Ut&'UH eE1uUe3IË t݋BhEBlEċBpEȋBtE̋BxEЋB|EԋE؋E܋EE䋂E苂E싂EE􋂠EE̋R8 ЉE̍EM $w&= ǀǀ UPhUĉPlUȉPpỦPtUЉPxUԉP|U؉U܉UU䉐U艐U쉐UU􉐜UUH eE1BhEBlEċBpEȋBtE̋BxEЋB|EԋE؋E܋EE䋂E苂E싂EE􋂠eEE$*%uzU PhUĉPlUȉPpỦPtUЉPxUԉP|U؉U܉UU䉐U艐U쉐UU􉐜UEe3uU'UH eE1uUe3;Ë t݋BhEBlEċBpEȋBtE̋BxEЋB|EԋE؋E܋EE䋂E苂E싂EE􋂠eeEEMEE$#A ǀ UPhUĉPlUȉPpỦPtUЉPxUԉP|U؉U܉UU䉐U艐U쉐UU􉐜U&'UHeE1 uUe3DË t݋BhEBlEċBpEȋBtE̋BxEЋB|EԋE؋E܋EE䋂E苂E싂EE􋂠eeEEEE$="B ǀǀ UPhUĉPlUȉPpỦPtUЉPxUԉP|U؉U܉UU䉐U艐U쉐UU􉐜URUEttS̪ -x0̪ t& tƂu̪ ]Ã뷐t&UE]fU($]ӉuƉ}auG P B$8 @ @fxwȪ ]u}]Ít&$h~$V~~6~0  ~eB fPfqt&Ȫ 냡 @($u4 B >PED$ D$T@($Jx?t׋~,E끃?tw B @s t x uU븍UWVS,EU]eE1$=S} et t C(;E \D$$1D$/$.$fBCBCB C BCBCBCBCB C B$C$$ Ax$$+$1 Qfy 8B$u 'Pt8ӍvuPu A 9~EQ뽋RUe3,[^_]Ë D$$D${ E fC($XE $Ī  t  @xu.x(mit&h$T$w|D$D$$'!S$*t 8bD$#D$$DD$ $#D$0D$$D$ $$]E fy\$D$$.f{t1҉C8vC9wC fKF 9|uD1Y$[tND$T$ D$$%$TD$#D$$D$ $D$ D$h뉋D$T$ rD$T$ ['UED$ D$E D$E$Í&U( ]Uu}@ p8E t-t#M9t)E $D$Ӌ Ƃ]u}]Ív9EuߍU]u$Dt*D$ D$ D$$]u]$ t#D$$Dt]u]1D$$t$-tD$$tD$5$t p^dt0D$$`xD$$H` aD$$":D$$ U$u}<u}]É'UD$$BÐUWVS,]E$Eԡ 9E} 1 EEE }UEUE?+E;ET?%uMU%uEEEEEt&t\}uVCA1ۀ<  t W1Ҁ<    _GJ   { A1Ҁ<  t 1ۀ<  t 1, A1Ҁ<  t x1ۀ<  t )Ӊ YA1Ҁ<  t 1ۀ<  t Yr iA1ۀ<  t H1Ҁ<  t 1 4A1ۀ<  t M1Ҁ<  #  ;   %  nA1ۀ<  t P1<  t 9 4H<  t <2C< H1Ҁ<  t É  <   a1e 1҃ PB<‹  C< H1Ҁ<  t É T H o  1 1 L 1  D$ $  S   1 1ۃ 1 N 1ۃ 1   c  뮋 { 1  1 D, 1 1 ( 1)?tP;t1I?tc;tDet1fvI&  [v&A9U( UtNu@D$$1fU@$>UD$T$$致1Í&뷉'U t@$bÍt&$OÐUS ]@xt$M1[]Ív $c˻k)t ) ~ $u=uJ띐&UWVS]C EEt'BE9Xt 9EBxDEE"$$Uti$U;t[tQ<$u;$\tE1Ʌt'1Ґ3эTBЉDGu <.1*tC/"}t&u }Ⱥgfff)ʉ$M 3몋B fx  t $H ER R 9ul3J3DG2LЃDGu3J7t&'UED$D$$ÐUS ]t4 \$D$@($tïftуt[]Ã1[]á tƀ U$ nÍU tC t)$ D$@$h ,$ÍU uÃh$u tzuuD$B$1$ UWS= ]t# \$@($"ti8t1[_]U$ ÍU h$zu 1ҁ`lɉ U ,$:u# 1@0t@ǀɉÐUSÃ$ED$$萯t EU 1 $[]Í& E93)ѺMbE+ $[i])ʍÍm@BEfUWV StEt&UE$ ÍU $  Í&U(]É}׉ut+ t$ԩ$̭$   u1]u}]Ðt&5 t9ƉE~؉ED$:$Dt&)؉E8u3;EtEE뜋U$菪UDΐ&UWVS }t&7w$<1ۍF;futڃ [^_]À= u|1ۍFfU $螧t$}?뢋U 1tFU t [^_]ËE 8%1ۃ [^_]$Q$(묍v'U]]uu eE1}D$$ 9D$$A1 󫍽D$ |$$w t74$1=$蚩Ue3c]u}]=uىЉD $4=v DžVL$T$$";t D$)؉D$$x%D$,},$FCD$T$ $虥9D$'}'$艤F D$ |$҉T$ $B9V ZD$=}$FgfF,fF'fF tD$|$$薤=+F,u僽&"V f'u災5vuݻv1$蘦^DžUD$ D$D$ $賧D$|$$tD$ |$$U =J>="C,fFȃ'fFffffF FD$F$FFD$F $ҹF F D$F$蹹ffV"FtD$|$$ۡffN$ou t4D$ ۉ\$|$$蔢9YffF&pDžD$$M‰FONL$ $RD$ |$ۉ\$$ա9;\ D$\$$聠9V\$ $D$ |$ۉ\$$M9V NfKL$F,D$$9mFV $D$uXNDžDžxBw$ɠT9u $跡FzD$T$ $О9RavUWVS,}?oM99<$r/EEED$E$j$ԟ<$ʟD=wlj|$\$D$ 1D$D$E D$$荡ED$E $zpM:G11,[^_]:G&:GԐU ]] uu8X t$P胜t ]u]É4$轝t꡼  Ī  @uҍYځ ~ $֟t P1\$ D$T$4$} @ 냐UUM tE JɉBB t]Í&U E D$D$E$Í&'UM EQPQPQ P ] Uuu }}]tG4$軝;Gs8tt$$؉GG )؉G]u}]Ðt&1ꍶUuu }}]t:4$K;Gs+Gtt$$q_)_]u}]1U1Uw t  ]Ít&~@]ÐUWVS @; ~+D$ $袲tu  @  1@~5  t9|B9|Ãx)= ٍ&t9y[^_])ډ]9ÉU}1t));}u U Qt)ڃ9u9|UD$ DD$E$D$@u @98QY)ȃEtR);uuITft:)؃9u1u衼 @L$4$D$ D3D$t U@L$$D$ DD$tu랐UW1Vơ S@H~t&9ǃu[^_]É UV S@xt p 1@P~v9Ãu[^]ÍUWVS< }u+E 1))ЅT$U D$$})9ΉM~sv E衰 <P(@]UEܐt&M1ҋEM܃~uMm 99u|Ã<[^_]Ëu T$3D$)Љ$՚U )9U }̋M  +U EI< UЋH(@M؉Eԋ]1ҋE؃ۋ 8~t&uUЃE 9Uuƒ<[^_]Ð UWVuSt2 vQ(1AH~u[^_]ÐUWVST Q 8E ] 1[^_]Ë1҅C5u&UWVS }u EtHtDxS~Dt=D$<$uۻ<$= [^_]û [^_]1ۉ4$胍룐US t0PBt$؃[]Ëuߐt&[]ÐUMU tQ1]Ð Ut]Í 1Ut]É'U] U]@xÉ' UB fxxMfxxFBtt]Ët u勀]Ít&]1ÍUE]U uM}]fy]u}]Ø;ȭ }5 tۋtp0x@fEtf2tf91tEf1량'UE$M t$]fy$t$]Ít&;ĭ }᡼ t؋t΋xf 1ff 1f …tf11tf뉐&U u։]Xt.L$$t$D$$]u]Ít&D$Í'U u։]Xt.L$$2t$D$$^]u]Ít&YD$Í'UXuE5 ]U }MfE]FfUfMĉuȋu]u}]á Et⋰tf}xu;5ȭ u}fwfwfwuԋpED fT0fL0f\0 Eȋ@ExM]ĉ}EuƉ]fEEMf9ufuf]~Ef;E~]Uf9UE}EMfEf9}ufuMgfff49)‹Ef9]fUfP;f}1 )kdUfBEf9EUf9UEU)k<hʋ]i-fff)fihf)f UЋMȋ]EuT$\$D$t$ A$ڿ$R ]ЋC9}Љ1EU)k<]EU)k<HxAًu))kdfFff@2E}f0UfL0Mf\0UMfU @1t $nÍ&UVS E ]uf;ĭ ffEfEf ED$ED$É$f}Cf}t&2 f}Zf}vkUD$$T$ISf [^]á @T$$׽UD$T$$ [^]f}f}fu(Ef=v8Ef=|U [^]EUfEEfUf=wȋUy뽍& ED$ED$$yf}Xf}Ft&fEHffE*f} ED$$D$U ~؉m¡ @t$1ÐUXE]Uu] }fy]u}];5ĭ } tًtπfYfEfyȭ 9EE|u9}̉} fvEU% EE% Ex9E= G}EEEԋ}x(@ud1EEԃ@9|/B9uGf9fOE}tU$>= }ԋUԃEE B;Eu xU}؋9 BE܋M1KB xueӋE AD$AD$D$BD$BD$ U܉t$D$$$1GE9fOfOfOEf}=ȭ 9}f9׉Uufg&1Ef0 U( ]u}t1]u}],t f+A< Q Bf~fz~ |ĭ BtD$ȭ A @$m~x D$ @ @$=~p@ Exp % á  @Exuȭ E11ۋȭ pU,3D3AD3AD3 A 9}~ω2D2AD2AD2 UA ztfAd붍v^Upf8tfUpfxtf@Upfxef@ZEǀ1 xt$} ǀxUWVS UUr@<Ez(R\f9Gftdf9|_Gftcf9^E tb&UD$$f9|ff9~E$.1 [^_]GfwfuE f_ud 랉k9U…]!É'U( uu}}]u1ۉ؋u]}]ÉtE tD$P$a{EtD$ 4$H{C(~FM fCfEEfCfKfC fMMfCEfK @C f{ fCH1ɋEHM@@@@@ @$@@@0@4@8f@,fH.f@f@@f@Df@Bf@F~@(1Ƀ}ffx 9uuMUU A9t:UM苂ALy}1G9-G;E }O ȃfG EuCEP9t"E9u}fO 둉$1z}u؃fO PvȋMQ뿐t&U8uu]U}] }xMx txy1ҋ]Ћu}]GH9GEE;Eͅu)uU+UG D$G ED$ GT$$D$!{p4EۉB0GBGB~6EJ(EEv4w(E E 9]uz8$UMUA )EA)‰U]Uuu]}u]u}]Ë t19tf؋[Lt9u¡ u(D;ph;pdt&t;p`u;5 @`u  CLBLF u8Nx0V(1E:t$xNV(E ;M}V($wx$ox1;5 @hu |;5 @di ZCLZ&'UWVSMUEE }u D$T$ L$E D$E$Etw]~p} 1EEX(D$E $QvEH(1tj:9s 9wE E9EuEE[^_]á @)ЉE B u @)ȅE)ҋE$qEE[^_]ÐUHuu]U}M]}u]u}]F tE ЉEE !E!ЉʉEE!ʉfẺf)!fẺˉUfUUfEE fUf)Vf9UfE~E))Ef+EfEVf9U~E))E Ef)fE fEڋ B9,B;E ;}9M  EfEUf9UFHfE΋ fMfEEUfEEf;BM䘍@V(EfMMč@Y(ЉEEf9EUEMfUUEEfMU#MfKfEMEf9M|EfEMȋU܋ 9MtSftf;UUf9S}fSUfSfSfEEUf9Uf@f@|Mă fEEEf9A%U]~fV f^t EF@~uA;E|6N9E*f9U|$f9M|EfVfN fVHf+Mf+UfHfFUMff ߈BEfN<UM f^@fF>1fVBf~DfNF fMࡴ MEfMAU(E D$ED$ED$ED$ ED$E D$E$u ɉs1҃u'US$]U tLC tLT$$CFD$CDD$CBD$C@D$ C>D$C<$D$@1$[]Ã$[]^&'U$t$Eu $1t$]@ t$t$]v'UWVSUE D$D$ D$] \$E$gEt`1]1EX(D$E $pt:]K(]19s 9w ;}uE[^_]ËE$JEE[^_]ÐUSE]D$E $4tEE ][][]Í&'US$E]D$E $D$tEED$E$D$r$[]ÍU(E D$ED$ $OtEED$ED$ $Ív'U(EED$E D$E$ÍU(E ED$ED$ $ÐUS$] P;Э @;̭ ~2̭ ̭ Э ԭ D$ح $Pح ح tZE \$D$ D$D$ԭ $D$aoح $[]@;̭ Э ~vvح u$1[]É$so1ح ԭ 믐US]D$/$n1tB)؃[]ÍvUS]$[]ÍU(]]uu eE1$t$n1҅xЋUe3u]u]Ãu Aqt&wl8u$o=w։\$D$$Ip$Et9tD$$VnuƅfDž.אU]U ]ÍUE] ÍvU( D$ D$D$ $0l x!D$ D$%D$$l x!D$ D$/D$$k t8ur$:D$ p$ D$oE ED$ ED$D$$^m$ D$o$ qD$ D$8D$$;khv'UUt tD$$:nølF됍t&US ]t!tD$\$$n[]$n u㐍t&U(=ܭ tá D$ D$D$ $uj x!D$ D$%D$$Kj x!D$ D$/D$$!j t8ug$:D$Nn$ D$9nE ED$ ED$D$$k$ D$mÉD$ D$8D$$isv'U( D$ D$D$ $Pi x!D$ D$%D$$&i x!D$ D$/D$$h t8ur$:D$)m$ D$mE ED$ ED$D$$~j$ D$l$-nD$ D$8D$$[hhU1]ÐUU]Ít&'UWS]Ct$iCt$iC t$iCt$uiCt$fiCt$Wi1߹ \$ $.[_]ÐUS t []Ðt&$Hgtމ$Bj =w̉$`k t&\$D$ MD$D$$l$UWVS tR1t@wD$ @D$ l$u pF ؁fEvL4V&F"N$)ӋV)؋Fҋt:kt$]9vwċ+Ճ[^_]Åt؉$4ft F fEGaD$ \$l$9F fE뛐UMbVS ]u؉)ʉUi)i@B]Ee8uEUEUt$$htك 1[^]U҉WVStQ:tLtHÍz t&[t6:Cu~uu1uC ft[^_][1^_]À~u㍶' UUtt @l]dt&]ÐUWVS E 8= UE8Et&8CPÄuu„>u}&fC !ˆSyD$ $idÉuE u t&]E$Leu [^_]Ít&Z8VD$ $dEC!‹EPf@ >QUfS [^_]EfC {D$ $cUÉtfC !ˆS] 1U1ɉSUE t 19‰u)9tʋu[]ËӉ; t; u݉ []Ë t&UVS]u SvH@Q0HHuBdwHH~BdBhwBlwBpF%kBtBxwqB|Sw^wRwF;XCT"`\twpP$Lw"[^]$9_SaBdsaTt&$ =S\(`$D=S$<STX$<S$h=SLP$=PS$:S$>S$?>SXF$W>S2$@<S$h<YSE=[^]>$8 S$9 S$L9S$:S>$8S*$;S$;pS$<\St&$:DSBtL$,;!S$4: SZt&$`:S^$>S"$9SBdzJdr==$5O^``aa@ffgg@iijj@ kkll@mmnn@oopp@qqrr@sstt@ uuvv@$wwxx@(yyzz@,{{||@0}}~~@4($|9SD$$/ZS'UED$$Ðt&UE D$E$t EZÉ'UWVS,]ܭ }ۈtܭ E D$E$JD$D$$YEt$$D$ZPt $ׄu$= ҉ ǀtt$Yt$Yt$Y+$Y t! t‹u ܭ ,[^_]$>k$_ UD$|]Ӊ}lju$Wt؋u]}]É$^Z=v\$t$<$Wf7|v'UWVS,UeE1] hډǍYD$|$SWtLt&{D$|<$)Wt=+)9uӋ9uƸue35u,[^_]ËiZU t$( uÍ'UWVSl5 EU e=}11Džt]9vD$$tރ~΋$D$D$D$ $Uu~$ D$|Zt 1pu拕1~RUe3El[^_]Ë$KD$>D$D$ $T05  DžDžF(Dž&$Ʃz4Z,$l= Nƅ&9t,D$\$$薨tƅx0fuƀ 9F(\, 71s(C01ɉڋ@(tB< @(~9u\$<$9C(t @D$<$D$A2C(C(u\$<$(2Ct$TC t$TCt$TCt$TCCC CCCCC C$D$$C4tO  t; $$7$t$u̸1׹ 󫍅T$D$$舴t5\$ $>G0$UB(BBB BBBBB B$W0$1vh ${UUED$$Ð8 UMU 4 t! ] D < @   Í&'UWVS D < t 5@ 1$ 9U~D D$$ )D$( $Pi( @ u  @ ۉމ< $R< < tt;لu A< ƒ< tt  ډΉ < 4$+RT0v!z z uD0P@ : ( 8#< < ;@ <0   1 C< ƒ [^_]Ív$ D$( $g( ġD $Q k( $>Qf S( t3$O8 ( $O8 $ < k`<   &US]t&[9tu[]ÍU8 Eң4 t8 E:$zQ8 8 Et&'U< ;@ tB< J- $>v'UWVSuEEEf2 9E 9 tY^tf\ = E]}X~}u$d?Eut& u [^_]Ã}%t w3v7NDX@t"?t:c$ȱ$AD$(?u=H 2$A!- FǐkÍ@ЃwUEE!GxЃwZEE}ljEuՋM一AE81GrvC<$$VDC /tn|$$QADtŀx  2 :, x=u$,@B, x딀u$@ , xnUD$ $D, x$G, $@G=@2 9t ,  2 9,  1_, x$ExED , 1; $! ID, |$$X@, x,, ^$D$du2 9t $pA,   E1tT.OtECuEUD5D$ D$D$$Bu*t;EtVE8u 2 9t $pA,   $?, x, $XAD$$@$$@D$, D$tUWVS u] u0>;$td8>$uր~<$uB>DBu.t*t/t߀>tڀ;$u{<$uBDAu.t*t/t>t܉dt# [)^_]à [^_]à 1[^_]ÍUWVS,EU܉M؃}}}t},1[^_]EUMB$R"A&׉UA }E9}]UuZe9M܉$L$Du։+U}U>}M؅t:MUfV AfT 0L EأP ,L [^_]Éu}}^E؅uRMAfA"fAD$A$WUBBX;]vHEPB;]wEUX$@"B&Í<|$B$5WM9]ƉAsOt&1B;]wuEUX$UMB$I"<MJ}MGUJ"B$MȉEB&}r1 9D$E܉$Cu9],E,ULEf@&@ fB D$B$5VMƉAA X;] 1B;]w1+U}UE']؅EEx"P}U6UBfB$fBD$B $UMƉA AX;]L1B;]fwE71;]E\v'USÃ$tEUMED$$芡$[]Ít&Uɉ]ˉu։}t $>t ]u}] ]u}]눐&UWVSlUEe M1ڈ$d@$O =    $.A$;$37) ~+E91t$ D$T$$EsD$|4$;uC($qƅ 8! 9u9!:Bu:!:BV9(W:BX:B Z($  [D,A( @C(T4~t  $t '$$赎$mE u(= BtD$$1ҋ]e3l[^_]úE25 `Pt`D$$@I W9HXu @Ftt ҹHF L$$xDD$=3x|Pf$D$t$$菜AH$D$tBltqAtHBktHhxAtHIBjtH*mAtH BwtHuAtHBvtHtAtH BntH pUY4$H$ECǀt;!1:BB D$+$6K ƅBx*A8Nu^AxuOY X<Zu$JY@pD^HLL:P(TX\`dhHbCdWI$=H2  :vA:wA:x1= $W;D$$vD$;NjO S fJGD$t$$RBH$D$7jALBkHlA@fBmDKnAh0Bq`tAPBuTvAXBw\xAdCX4$H$E  :A:A:1= $>9D$$D$f9ǃ=  n_X$Wkv/WC= =q>  q >*<$D$6u݋FD$`P$84FD$ FD$$LDD$9t&&2&&= :t,$GT$FD$ $R)jWA fP uI)tDž$T$n5@ tЍt&= $(FD$ +끿@2wWCA(t =oz o >[<$T$4u݋FD$`$6 FD$ FD$$DD$$CƅD$i$.DžtxmD$,$.AKK+u 0t&$09u닅t$$D$2uыGevtr$D$`5D$`PËG$5ۉHC F\$$32B @fRfHD$$D|"$ E ًK=H  $FD$){(~`1ƅ  9t>D$+C,$-uƅօWANXYZC8{,PDz+Lz'BXS f:ƅX;v$kF ƅ\t&tFʃt0<$Juzt Zڄu^Z $ YD$J$tX3B f@$PFۿ.t$$DT$跿$pCF|$$(DD$菿$ D$ D$G$LED$e$J$ R B4 4ǀ t&$CƅPC@$mFD$F|$$CD$襾C$ $DD$yCx*lff`@ @JftD$D$JD$ cFD$ D$$-q$ z)C C,D$ t$$ЌB@$D$踍VP4fB @Hf$D$D$JD$ cFD$ D$,q$8X,c$P(4$Zz&h0AK,QE0BS,QA @DftD$D$JD$ cFD$ D$$+p$$J $J$- 9wuG;uQz%4B.S8&t&z):B @Ff$D$D$JD$ cFD$ D$*q$XPvB @Ff$D$D$JD$ cFD$ D$c*q$ƜSbPz)3@ @Ff~w$D$D$JD$ cFD$ D$)q$ ,XP$JC8X$JC,ZR$JU$JD$ t$$ԈB@$D$載u1Q<$J>ZR A$D$lu*SA@,$D$BtX4$ÜQ$JPUWVSK,҉U=K/D$X $#<ǃEX "]U؉ƃ"E\ < É<$D$D$ KD$D$^'<$V%E9Et=UMD Ut(؉ƃ"X\_E9Euƍv"GE,[^_]%$f1,F9v'W:tFUEm&UWVS,UʉM܉EU܉NjEUR"9fUUR$fUUR&fUsIUZf|49t*D$E$uދM܉E,[^_]zE]\EÍUT$UB$)-9NjExvM&9B9wUM܋BUE}tq}]܅uVEf@"@fBD$B$,UBBX9st&HEP9Br,[^_]ËUBfB$fBD$B $E,NjEx @X9sL9B9fr,[^_]ËEf@&@ fB D$B$+NjEx@ X9Y 9B9މr,[^_]ÍUWVSà UP$@"‰US&Eu9ƉE|'S&C<C +E)ЋSE;]}EEEEE<\j<$<% E c]EU:tM]At;]u}t& L[^_]Àz/Qr]EDAu.t*t9v <EE  EE܋VDAuԀ.tπ*tʍt&E  %EEE  eEM^DPuÉuD$$hMd1L[^_]ÍSUS^t ,E  E{<i%sfDAu.t*t/vtހ>tكuv>KM{%=U u}t$ |$D$L$n EUD$ T$D$L$G7Mt$ L$D$ M$#%E}|$ D$D$)M$_ED$ ED$D$$}|$D$EM$ED$D$RM$LމE_M]VEELAED$;$EMUEEuЀ>$?D$;$D$;$uD$+$c=ELEtEUȉupE+D$;$J&Lމ|E}]EbM;EzuDAXUDAF8. grub (GNU GRUB 0.97)strtoulRun "gdb %s %d", and set HOLD to zero. batchboot-drivedevice-mapholdinstall-partitionno-config-fileno-cursesno-floppyno-pagerpreset-menuprobe-second-floppyread-onlyverboseversion rW9H*ڙÙlP:1serialWrite %d sectors starting from %d sector to drive 0x%x (%s) %x%xunknown subfunc %d Attempt to open drive 0x%x (%s) asmstub.cgrub_scratch_mem == 0simstack_alloc_base != ((void *) -1)disks == 0disks(((((0x77e0) << 4) + (unsigned long) grub_scratch_mem) >> 4) << 4) == ((0x77e00) + (unsigned long) grub_scratch_mem)(((((0x7000) << 4) + (unsigned long) grub_scratch_mem) >> 4) << 4) == ((0x70000) + (unsigned long) grub_scratch_mem)((0x68000) + (unsigned long) grub_scratch_mem) % 16 == 0  0grub_stage2[Hit return to continue] Error %u: %s GNU GRUB version %s (%dK lower / %dK upper memory) consolehercules<mݺݺDOݺݺݺ¹ݺݺoݺݺݺݺݺݺݺݺGNU GRUB 0.97Filename must be either an absolute pathname or blocklistBad file or directory typeBad or corrupt data while decompressing fileBad or incompatible header in compressed filePartition table invalid or corruptMismatched or corrupt version of stage1/stage2Loading below 1MB is not supportedKernel must be loaded before bootingUnknown boot failureUnsupported Multiboot features requestedUnrecognized device stringInvalid device requestedInvalid or unsupported executable formatFilesystem compatibility error, cannot read whole fileFile not foundInconsistent filesystem structureCannot mount selected partitionSelected cylinder exceeds maximum supported by BIOSLinux kernel must be loaded before initrdMultiboot kernel must be loaded before modulesSelected disk does not existNo such partitionError while parsing numberAttempt to access block outside partitionDisk read errorToo many symbolic linksUnrecognized commandSelected item cannot fit into memoryDisk write errorInvalid argumentFile is not sector alignedMust be authenticatedDevice not initialized yetNo spare sectors on the diskOverflow while parsing number Filesystem type is %s, unknown, using whole disk Partition num: %d, [BSD sub-partitions immediately follow] BSD Partition num: '%c', No BSD sub-partition found, partition type 0x%x %d,%c)%d) Possible commands are: Possible disks are: cd Possible partitions are: Possible files are:<%d, %d, %d>fatext2fsminixreiserfsvstafsjfsxfsufs2iso9660ffs CD001Non-supported version (%d) RockRidge chunk `%c%c' ReIsErFsReIsEr2FsReIsEr3FsReIsErLB  %s     ??1~3~5~6~ABCDFH4%d: %s Press any key to enter the menu Booting %s in %d seconds... Use the %c and %c keys to select which entry is highlighted. Press enter to boot the selected OS or 'p' to enter a password to unlock the next set of features. Press enter to boot the selected OS, 'e' to edit the commands before booting, 'a' to modify the kernel arguments before booting, or 'c' for a command-line. Press 'b' to boot, 'e' to edit the selected command in the boot sequence, 'c' for a command-line, 'o' to open a new line after ('O' for before) the selected line, 'd' to remove the selected line, or escape to go back to the main menu. The selected entry is %d Entry %d will be booted automatically in %d seconds. The highlighted entry will be booted automatically in %d seconds. Highlighted entry is %d: Password: Failed! Press any key to continue...grub edit> kernelgrub append> Booting '%s' Booting command-list 8hhhhegfhhQg+gh>gheghhhhhhhhhhhhhh%hhhghhhhhhhhhhhhhgfhhhhhhhehhhhhghhhheehhfhXhhheghe=fhhelhhhhehhgghGhAddress 0x%x: Value 0x%x [%d] Filesystem tracing is now off Filesystem tracing is now on APM BIOS information: Version: 0x%x 32-bit CS: 0x%x Offset: 0x%x 16-bit CS: 0x%x 16-bit DS: 0x%x 32-bit CS length: 0x%x 16-bit CS length: 0x%x 16-bit DS length: 0x%x No APM BIOS found or probe failed Debug mode is turned off Debug mode is turned on ,%s%d+%d%s%d+%d,%d[0-%d]%s%d[0-%d]%s%d[%d-%d][%d,%d,%d]VBE2 VBE BIOS is not present. VBE version %d.%d is not supported. VBE version %d.%d YUVUnknownTextCGA graphicsHercules graphicsPlanarPacked pixelNon-chain 4, 256 colorDirect Color 0x%x: %s, %ux%ux%u Mode 0x%x is not found or supported. Mode 0x%x is not supported. Switching to Mode 0x%x failed. Whole file: Partial read 1: Partial read 2: Header1 = 0x%x, next = 0x%x, next = 0x%x, next = 0x%x Header2 = 0x%x, next = 0x%x, next = 0x%x, next = 0x%x Max is 0x10ac0: i=0x%x, filepos=0x%x Checking if "%s" exists... yes no (%cd%d,%d,%cDiffer in size: 0x%x [%s], 0x%x [%s] Differ at the offset %d: 0x%x [%s], 0x%x [%s] Internal pager is now %s --name=--cursor-address=--clear-screen=--enter-standout-mode=--exit-standout-mode=name=%s cursor_address=%s clear_screen=%s enter_standout_mode=%s exit_standout_mode=%s saved--dumb--no-echo--no-edit--timeout=--lines=--silent (no echo) (no edit) (dumb)%s%s%s%s Press any key to continue. --unit=--speed=--port=--word=--stop=--parity=nooddeven--device=/boot/grub/stage2--stage2=--default=--oncer+ (nd): (hd%d (fd%d): (fd%d) (hd%d,%d) (hd%d,%d,%c) $1$./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzEncrypted: %s --md5----type=netbsdfreebsdopenbsdbiglinuxmultiboot--no-mem-option--force-lbaWarning: the option `d' was not used, but the Stage 1 will be installed on a different drive than the drive where the Stage 2 resides. AERMH %d sectors are embedded. Running "embed %s"... %s%ssucceeded failed (this is not fatal) --prefix=/stage1/boot/grub/grub.conf--force-lba %s%s%s%s %s%s %s p %s %s Running "install %s"... succeeded Done. --all%s: %s blink---forceMSWIN--no-apmdrive 0x%x: C/H/S = %d/%d/%d, The number of sectors = %d, %s EISA Memory BIOS Interface is present Address Map BIOS Interface is present Lower memory: %uK, Upper memory (to first chipset hole): %uK [Address Range Descriptor entries immediately follow (values are 64-bit)] Usable RAMReserved %s: Base Address: 0x%x X 4GB + 0x%x, Length: 0x%x X 4GB + 0x%x bytes /e2fs_stage1_5/fat_stage1_5/ufs2_stage1_5/ffs_stage1_5/iso9660_stage1_5/jfs_stage1_5/minix_stage1_5/reiserfs_stage1_5/vstafs_stage1_5/xfs_stage1_5exclamnumbersigndollarpercentcaretampersandasteriskparenleftparenrightminusunderscoreequalbracketleftbraceleftbracketrightbracerightcontrolsemicolondoublequotebackquotetildeshiftbackslashbarcommalessperiodgreaterquestioncapslockF1F2F3F4F5F6F7F8F9F10deleteblackbrownlight-graydark-graylight-bluelight-greenlight-cyanlight-redlight-magentayellowwhiteblocklist FILEPrint the blocklist notation of the file FILE.Boot the OS/chain-loader which has been loaded.catcat FILEPrint the contents of the file FILE.chainloaderchainloader [--force] FILELoad the chain-loader FILE. If --force is specified, then load it forcibly, whether the boot loader signature is present or not.Clear the screencmpcmp FILE1 FILE2Compare the file FILE1 with the FILE2 and inform the different values if any.color NORMAL [HIGHLIGHT]Change the menu colors. The color NORMAL is used for most lines in the menu, and the color HIGHLIGHT is used to highlight the line where the cursor points. If you omit HIGHLIGHT, then the inverted color of NORMAL is used for the highlighted line. The format of a color is "FG/BG". FG and BG are symbolic color names. A symbolic color name must be one of these: black, blue, green, cyan, red, magenta, brown, light-gray, dark-gray, light-blue, light-green, light-cyan, light-red, light-magenta, yellow and white. But only the first eight names can be used for BG. You can prefix "blink-" to FG if you want a blinking foreground color.configfileconfigfile FILELoad FILE as the configuration file.debugTurn on/off the debug mode.devicedevice DRIVE DEVICESpecify DEVICE as the actual drive for a BIOS drive DRIVE. This command can be used only in the grub shell.displayapmDisplay APM BIOS information.displaymemDisplay what GRUB thinks the system address space map of the machine is, including all regions of physical RAM installed.dumpdump FROM TODump the contents of the file FROM to the file TO. FROM must be a GRUB file and TO must be an OS file.embedembed STAGE1_5 DEVICEEmbed the Stage 1.5 STAGE1_5 in the sectors after MBR if DEVICE is a drive, or in the "bootloader" area if DEVICE is a FFS partition. Print the number of sectors which STAGE1_5 occupies if successful.fallbackfind FILENAMESearch for the filename FILENAME in all of partitions and print the list of the devices which contain the file.fstestToggle filesystem test mode.geometrygeometry DRIVE [CYLINDER HEAD SECTOR [TOTAL_SECTOR]]Print the information for a drive DRIVE. In the grub shell, you can set the geometry of the drive arbitrarily. The number of the cylinders, the one of the heads, the one of the sectors and the one of the total sectors are set to CYLINDER, HEAD, SECTOR and TOTAL_SECTOR, respectively. If you omit TOTAL_SECTOR, then it will be calculated based on the C/H/S values automatically.halthalt [--no-apm]Halt your system. If APM is avaiable on it, turn off the power using the APM BIOS, unless you specify the option `--no-apm'.help [--all] [PATTERN ...]Display helpful information about builtin commands. Not all commands aren't shown without the option `--all'.hiddenmenuHide PARTITION by setting the "hidden" bit in its partition type code.impsprobeProbe the Intel Multiprocessor Specification 1.1 or 1.4 configuration table and boot the various CPUs which are found into a tight loop.initrd FILE [ARG ...]Load an initial ramdisk FILE for a Linux format boot image and set the appropriate parameters in the Linux setup area in memory.installinstall [--stage2=STAGE2_FILE] [--force-lba] STAGE1 [d] DEVICE STAGE2 [ADDR] [p] [CONFIG_FILE] [REAL_CONFIG_FILE]Install STAGE1 on DEVICE, and install a blocklist for loading STAGE2 as a Stage 2. If the option `d' is present, the Stage 1 will always look for the disk where STAGE2 was installed, rather than using the booting drive. The Stage 2 will be loaded at address ADDR, which will be determined automatically if you don't specify it. If the option `p' or CONFIG_FILE is present, then the first block of Stage 2 is patched with new values of the partition and name of the configuration file used by the true Stage 2 (for a Stage 1.5, this is the name of the true Stage 2) at boot time. If STAGE2 is a Stage 1.5 and REAL_CONFIG_FILE is present, then the Stage 2 CONFIG_FILE is patched with the configuration filename REAL_CONFIG_FILE. If the option `--force-lba' is specified, disable some sanity checks for LBA mode. If the option `--stage2' is specified, rewrite the Stage 2 via your OS's filesystem instead of the raw device.ioprobeioprobe DRIVEProbe I/O ports used for the drive DRIVE.kernel [--no-mem-option] [--type=TYPE] FILE [ARG ...]Attempt to load the primary boot image from FILE. The rest of the line is passed verbatim as the "kernel command line". Any modules must be reloaded after using this command. The option --type is used to suggest what type of kernel to be loaded. TYPE must be either of "netbsd", "freebsd", "openbsd", "linux", "biglinux" and "multiboot". The option --no-mem-option tells GRUB not to pass a Linux's mem option automatically.Break a command execution unless the user is authenticated.makeactiveSet the active partition on the root disk to GRUB's root device. This command is limited to _primary_ PC partitions on a hard disk.map TO_DRIVE FROM_DRIVEMap the drive FROM_DRIVE to the drive TO_DRIVE. This is necessary when you chain-load some operating systems, such as DOS, if such an OS resides at a non-first drive.md5cryptGenerate a password in MD5 format.modulemodule FILE [ARG ...]Load a boot module FILE for a Multiboot format boot image (no interpretation of the file contents is made, so users of this command must know what the kernel in question expects). The rest of the line is passed as the "module command line", like the `kernel' command.modulenounzipmodulenounzip FILE [ARG ...]The same as `module', except that automatic decompression is disabled.pager [FLAG]Toggle pager mode with no argument. If FLAG is given and its value is `on', turn on the mode. If FLAG is `off', turn off the mode.partnewpartnew PART TYPE START LENCreate a primary partition at the starting address START with the length LEN, with the type TYPE. START and LEN are in sector units.parttypeparttype PART TYPEChange the type of the partition PART to TYPE.passwordpassword [--md5] PASSWD [FILE]If used in the first section of a menu file, disable all interactive editing control (menu entry editor and command line). If the password PASSWD is entered, it loads the FILE as a new config file and restarts the GRUB Stage 2. If you omit the argument FILE, then GRUB just unlocks privileged instructions. You can also use it in the script section, in which case it will ask for the password, before continueing. The option --md5 tells GRUB that PASSWD is encrypted with md5crypt.pause [MESSAGE ...]Print MESSAGE, then wait until a key is pressed.quitExit from the GRUB shell.readread ADDRRead a 32-bit value from memory at address ADDR and display it in hex format.rebootReboot your system.rootroot [DEVICE [HDBIAS]]Set the current "root device" to the device DEVICE, then attempt to mount it to get the partition size (for passing the partition descriptor in `ES:ESI', used by some chain-loaded bootloaders), the BSD drive-type (for booting BSD kernels using their native boot format), and correctly determine the PC partition where a BSD sub-partition is located. The optional HDBIAS parameter is a number to tell a BSD kernel how many BIOS drive numbers are on controllers before the current one. For example, if there is an IDE disk and a SCSI disk, and your FreeBSD root partition is on the SCSI disk, then use a `1' for HDBIAS.rootnoverifyrootnoverify [DEVICE [HDBIAS]]Similar to `root', but don't attempt to mount the partition. This is useful for when an OS is outside of the area of the disk that GRUB can read, but setting the correct root device is still desired. Note that the items mentioned in `root' which derived from attempting the mount will NOT work correctly.savedefaultsavedefault [--stage2=STAGE2_FILE] [--default=DEFAULT] [--once]Save DEFAULT as the default boot entry in STAGE2_FILE. If '--once' is specified, the default is reset after the next reboot.serial [--unit=UNIT] [--port=PORT] [--speed=SPEED] [--word=WORD] [--parity=PARITY] [--stop=STOP] [--device=DEV]Initialize a serial device. UNIT is a digit that specifies which serial device is used (e.g. 0 == COM1). If you need to specify the port number, set it by --port. SPEED is the DTE-DTE speed. WORD is the word length, PARITY is the type of parity, which is one of `no', `odd' and `even'. STOP is the length of stop bit(s). The option --device can be used only in the grub shell, which specifies the file name of a tty device. The default values are COM1, 9600, 8N1.setkeysetkey [TO_KEY FROM_KEY]Change the keyboard map. The key FROM_KEY is mapped to the key TO_KEY. A key must be an alphabet, a digit, or one of these: escape, exclam, at, numbersign, dollar, percent, caret, ampersand, asterisk, parenleft, parenright, minus, underscore, equal, plus, backspace, tab, bracketleft, braceleft, bracketright, braceright, enter, control, semicolon, colon, quote, doublequote, backquote, tilde, shift, backslash, bar, comma, less, period, greater, slash, question, alt, space, capslock, FX (X is a digit), and delete. If no argument is specified, reset key mappings.setupsetup [--prefix=DIR] [--stage2=STAGE2_FILE] [--force-lba] INSTALL_DEVICE [IMAGE_DEVICE]Set up the installation of GRUB automatically. This command uses the more flexible command "install" in the backend and installs GRUB into the device INSTALL_DEVICE. If IMAGE_DEVICE is specified, then find the GRUB images in the device IMAGE_DEVICE, otherwise use the current "root device", which can be set by the command "root". If you know that your BIOS should support LBA but GRUB doesn't work in LBA mode, specify the option `--force-lba'. If you install GRUB under the grub shell and you cannot unmount the partition where GRUB images reside, specify the option `--stage2' to tell GRUB the file name under your OS.terminal [--dumb] [--no-echo] [--no-edit] [--timeout=SECS] [--lines=LINES] [--silent] [console] [serial] [hercules] [graphics]Select a terminal. When multiple terminals are specified, wait until you push any key to continue. If both console and serial are specified, the terminal to which you input a key first will be selected. If no argument is specified, print current setting. The option --dumb specifies that your terminal is dumb, otherwise, vt100-compatibility is assumed. If you specify --no-echo, input characters won't be echoed. If you specify --no-edit, the BASH-like editing feature will be disabled. If --timeout is present, this command will wait at most for SECS seconds. The option --lines specifies the maximum number of lines. The option --silent is used to suppress messages.terminfo [--name=NAME --cursor-address=SEQ [--clear-screen=SEQ] [--enter-standout-mode=SEQ] [--exit-standout-mode=SEQ]]Define the capabilities of your terminal. Use this command to define escape sequences, if it is not vt100-compatible. You may use \e for ESC and ^X for a control character. If no option is specified, the current settings are printed.testloadtestload FILERead the entire contents of FILE in several different ways and compares them, to test the filesystem code. The output is somewhat cryptic, but if no errors are reported and the final `i=X, filepos=Y' reading has X and Y equal, then it is definitely consistent, and very likely works correctly subject to a consistent offset error. If this test succeeds, then a good next step is to try loading a kernel.testvbetestvbe MODETest the VBE mode MODE. Hit any key to return.timeouttitleunhideunhide PARTITIONUnhide PARTITION by clearing the "hidden" bit in its partition type code.uppermemuppermem KBYTESForce GRUB to assume that only KBYTES kilobytes of upper memory are installed. Any system address range maps are discarded.vbeprobevbeprobe [MODE]Probe VBE information. If the mode number MODE is specified, show only the information about only the mode.qoxoooooojons[[xө0ϩ?M\j|ک@'̻1!˽2@ӻ3#~޻4$'5%*6^-7&08* 39( 0) !-_ ,(=+  ƣqQ /wWeErMrRLՠtTgyYJϣuUzLؠiIL͠oO$L3pP2>[{HU]} `aACsS-`MdD fF!gG"hH#jJ$)kK%lL&hl;:'xr'"(~`~)*\|+ޣzZ,أxX-]MmcC.SvV/uMbB0cM\nN1fMҺmM2,<3.>4/?58 9ż:μ;Ѽ<Լ=׼>ڼ?ݼ@ABCDS&2=G  ,7AOV [ Minimal BASH-like line editing is supported. For the first word, TAB lists possible command completions. Anywhere else TAB lists the possible completions of a device/filename. ESC at any time exits. ESC at any time cancels. ENTER at any time accepts your changes. Press any key to continue...grub> wxjVp $ν|*ƇGF0FؘiD[\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ     [Linux-initrd @ 0x%x, 0x%x bytes] [Multiboot-module @ 0x%x, 0x%x bytes] MultibootFreeBSDelfkludgeNetBSDa.out linux 'zImage' kernel too big, try 'make bzImage' bzImage [Linux-%s, setup=0x%x, size=0x%x] vga=askmem= [%s-%s-and-data, loadaddr=0x%x, text%s=0x%x, C, data=0x%x, bss=0x%x, symtab=0x%x, strtab=0x%x(bad), <0x%x:0x%x:0x%x>, shtab=0x%x, entry=0x%x] /dev/.devfsddevice.cmap[drive] != 0stat (map[drive], &st) == 0/disc/part/dev/ida//dev/ataraid//dev/mapper//dev/cciss//dev/rd/%s%d%s:%d: error: %s %s:%d: warning: fd >= 0Unable to seekUnknown partition table signature Unable to read partition table: %s *map == 0*mapNo open parenthesis foundBad drive nameBad device numberIgnoring %cd%d due to a BIOS limitationNo close parenthesis foundNo filename foundDuplicated entry foundmap[drive]Probing devices to guess BIOS drives. This may take a long time. /dev/floppy/%d/dev/fd%d(fd%d) %s (*map)[i]/dev/discs/disc%d(*map)[num_hd + 0x80](hd%d) %s /dev/hd%c/dev/ataraid/d%c/dev/sd%c/dev/rd/c%dd%d/dev/i2o/hd%c/dev/cciss/c%dd%d/dev/ida/c%dd%dwrite_to_partitionis_disk_deviceinit_device_mapread_device_mapget_drive_geometryTERMunknownError opening terminal: %s. ANCURSES_NO_HARD_TABS D}ESCDELAYNCURSES_NO_PADDINGNCURSES_ASSUMED_COLORS%d%c%d%cCOLORFGBG[3%p1%dm[3%?%p1%{8}%>%t9%e%p1%d%;m[4%p1%dm[4%?%p1%{8}%>%t9%e%p1%d%;mNCURSES_NO_MAGIC_COOKIEF%d 2Kn,X   `  %KLINESCOLUMNS|'%s': unknown terminal type. CCNCURSES_NO_UTF8_ACSTERMCAPhhII00UTF-8TERM environment variable not set. TERM environment must be <= %d characters. Not enough memory to create terminal structure. terminals database is inaccessible '%s': I need something more specific. '%s': I can't handle hardcopy terminals. pppppppppppppppppppppp=pppppppppppppppppppppppppppppLppppppppppLLppppppppppLpppLppppL~v1O1                      !                             0          00          0   0    0ne XJ:WuCOut of memoryTERMINFOTERMINFO_DIRS/usr/share/terminfo%s/%c/%spNCURSES_NO_SETBUF^@^A^B^C^D^E^F^G^H^I^J^K^L^M^N^O^P^Q^R^S^T^U^V^W^X^Y^Z^[^\^]^^^_!#&(`}~^?~@~A~B~C~D~E~F~G~H~I~J~K~L~M~N~O~P~Q~R~S~T~U~V~W~X~Y~Z~[~\~]~^~_bdfhjlnprtvxz|~#uL8LyLLLoML~'*-03MCML!LLuMm`Mؠ)Һ\͠3ƣCՠϣ/أgޣL,L ]M-zLfMcML$LrMLJS ;L "%(+.147:=@CFILORUX[^adgjmpsuwy{}   !#%')+-/1  x2d2d2dJ2d<2d,2d2d"%s", line %d, col %d, terminal '%s'HOME%s/.terminfobwxsbxhpxenlhckmhsdadbmsgreslokhznxonmc5ichtsnrrmcnpcndscrcccbcehlsxhpacrxmdaisyxvpasamcpixlpixOTbsOTnsOTncOTMTOTNLOTptOTxrauto_left_marginno_esc_ctlcceol_standout_glitcheat_newline_glitcherase_overstrikegeneric_typehard_copyhas_status_lineinsert_null_glitchmemory_abovememory_belowmove_insert_modemove_standout_modeover_strikestatus_line_esc_okdest_tabs_magic_smsotilde_glitchtransparent_underlineneeds_xon_xoffprtr_silenthard_cursornon_rev_rmcupno_pad_charnon_dest_scroll_regioncan_changeback_color_erasehue_lightness_saturationcol_addr_glitchcr_cancels_micro_modehas_print_wheelrow_addr_glitchsemi_auto_right_margincpi_changes_reslpi_changes_resbackspaces_with_bscrt_no_scrollingno_correctly_working_crgnu_has_meta_keylinefeed_is_newlinehas_hardware_tabsreturn_does_clr_eolcolsxmcpbwslnlablhlwwnumncvbufszspinvspinhmaddrmjumpmcsmlsnpinsorcorlorhiorvicpswidcsbtnsbitwinbitypeOTugOTdCOTdNOTdBOTdTOTkncolumnsinit_tabslines_of_memorymagic_cookie_glitchpadding_baud_ratevirtual_terminalwidth_status_linenum_labelslabel_heightlabel_widthmax_attributesmaximum_windowsmax_colorsmax_pairsno_color_videobuffer_capacitydot_vert_spacingdot_horz_spacingmax_micro_addressmax_micro_jumpmicro_col_sizemicro_line_sizenumber_of_pinsoutput_res_charoutput_res_lineoutput_res_horz_inchoutput_res_vert_inchprint_ratewide_char_sizebuttonsbit_image_entwiningbit_image_typemagic_cookie_glitch_ulcarriage_return_delaynew_line_delaybackspace_delayhorizontal_tab_delaynumber_of_function_keysbelcsrcmdchcivismrcupcnormcvvisdslhdsmacsblinkboldsmcupsmdcdimsmirinvisprotrevsmulechrmacssgr0rmdcrmsormulflashfslis1is2is3ifkbsktbckclrkctabkdch1kdl1kcud1krmirkelkedkf0kf1kf10kf2kf3kf4kf5kf6kf7kf8kf9khomekich1kil1kcub1kllknpkppkcuf1kindkrikhtskcuu1rmkxsmkxlf0lf1lf10lf2lf3lf4lf5lf6lf7lf8lf9rmmsmmpadindnrinpfkeypflocpfxmc0mc4mc5rs1rs2rs3rfwindtsluchuiprogka1ka3kb2kc1kc3mc5prmpacscplnkcbtsmxonrmxonsmamrmamxoncxoffcenacssmlnrmlnkbegkcankclokcmdkcpykcrtkendkentkextkfndkhlpkmrkkmsgkmovknxtkopnkoptkprvkprtkrdokrefkrfrkrplkrstkresksavkspdkundkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkRDOkRPLkRITkRESkSAVkSPDkUNDrfikf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63el1mgcsmglsmgrflnsclkdclkrmclkcwinwingohupqdialpulsewaitu0u2u3u4u5u6u7u8u9opinitcinitpscpsetfsetbcpilpichrcvrdefcswidmsdrfqsitmslmsmicmsnlqsnrmqsshmssubmssupmsumrwidmritmrlmrmicmrshmrsubmrsupmrummhpamcud1mcub1mcuf1mvpamcuu1pordermcudmcubmcufmcuuscssmgbsmgbpsmglpsmgrpsmgtsmgtpsbimscsdrbimrcsdsubcssupcsdocrzeromcsnmkmousreqmpgetmsetafsetabpfxldevtcsins0dss1dss2dss3dssmglrsmgtbbirepbinelbicrcolornmdefbiendbisetcolorslinesdispcsmpchrmpchsmscrmscpctrmscescscesaehhlmelhlmelohlmerhlmethlmevhlmsgr1slengthOTi2OTrsOTnlOTbcOTkoOTmaOTG2OTG3OTG1OTG4OTGROTGLOTGUOTGDOTGHOTGVOTGCmemlmemubox1back_tabbellchange_scroll_regionclear_all_tabsclear_screenclr_eoscommand_charactercursor_addresscursor_downcursor_homecursor_invisiblecursor_leftcursor_mem_addresscursor_normalcursor_rightcursor_to_llcursor_upcursor_visibledelete_characterdis_status_linedown_half_lineenter_alt_charset_modeenter_blink_modeenter_bold_modeenter_ca_modeenter_delete_modeenter_dim_modeenter_insert_modeenter_secure_modeenter_protected_modeenter_reverse_modeenter_standout_modeenter_underline_modeerase_charsexit_alt_charset_modeexit_attribute_modeexit_ca_modeexit_delete_modeexit_insert_modeexit_standout_modeexit_underline_modeflash_screenform_feedfrom_status_lineinit_1stringinit_2stringinit_3stringinit_fileinsert_characterinsert_paddingkey_backspacekey_catabkey_clearkey_ctabkey_dckey_dlkey_downkey_eickey_eolkey_eoskey_f0key_f1key_f10key_f2key_f3key_f4key_f5key_f6key_f7key_f8key_f9key_homekey_ickey_ilkey_leftkey_llkey_npagekey_ppagekey_rightkey_sfkey_srkey_stabkey_upkeypad_localkeypad_xmitlab_f0lab_f1lab_f10lab_f2lab_f3lab_f4lab_f5lab_f6lab_f7lab_f8lab_f9parm_dchparm_delete_lineparm_down_cursorparm_ichparm_indexparm_insert_lineparm_left_cursorparm_right_cursorparm_rindexparm_up_cursorpkey_keypkey_localpkey_xmitprint_screenrepeat_charreset_1stringreset_2stringreset_3stringreset_filerestore_cursorsave_cursorscroll_forwardscroll_reverseset_attributesset_tabset_windowto_status_lineunderline_charup_half_lineinit_progkey_a1key_a3key_b2key_c1key_c3prtr_nonchar_paddingacs_charsplab_normkey_btabenter_xon_modeexit_xon_modeenter_am_modeexit_am_modexon_characterxoff_characterena_acslabel_offkey_begkey_cancelkey_closekey_commandkey_copykey_createkey_endkey_enterkey_exitkey_findkey_helpkey_markkey_messagekey_movekey_nextkey_openkey_optionskey_previouskey_printkey_redokey_referencekey_refreshkey_replacekey_restartkey_resumekey_savekey_suspendkey_undokey_sbegkey_scancelkey_scommandkey_scopykey_screatekey_sdckey_sdlkey_selectkey_sendkey_seolkey_sexitkey_sfindkey_shelpkey_shomekey_sickey_sleftkey_smessagekey_smovekey_snextkey_soptionskey_spreviouskey_sprintkey_sredokey_sreplacekey_srightkey_srsumekey_ssavekey_ssuspendkey_sundoreq_for_inputkey_f11key_f12key_f13key_f14key_f15key_f16key_f17key_f18key_f19key_f20key_f21key_f22key_f23key_f24key_f25key_f26key_f27key_f28key_f29key_f30key_f31key_f32key_f33key_f34key_f35key_f36key_f37key_f38key_f39key_f40key_f41key_f42key_f43key_f44key_f45key_f46key_f47key_f48key_f49key_f50key_f51key_f52key_f53key_f54key_f55key_f56key_f57key_f58key_f59key_f60key_f61key_f62key_f63clr_bolclear_marginsset_left_marginset_right_marginlabel_formatset_clockdisplay_clockremove_clockcreate_windowgoto_windowhangupdial_phonequick_dialflash_hookfixed_pausewait_toneuser0user1user2user3user4user5user6user7user8user9orig_pairorig_colorsinitialize_colorinitialize_pairset_color_pairset_foregroundset_backgroundchange_char_pitchchange_line_pitchchange_res_horzchange_res_vertdefine_charenter_doublewide_modeenter_draft_qualityenter_italics_modeenter_leftward_modeenter_micro_modeenter_near_letter_qualityenter_normal_qualityenter_shadow_modeenter_subscript_modeenter_superscript_modeenter_upward_modeexit_doublewide_modeexit_italics_modeexit_leftward_modeexit_micro_modeexit_shadow_modeexit_subscript_modeexit_superscript_modeexit_upward_modemicro_column_addressmicro_downmicro_leftmicro_rightmicro_row_addressmicro_uporder_of_pinsparm_down_microparm_left_microparm_right_microparm_up_microselect_char_setset_bottom_marginset_bottom_margin_parmset_left_margin_parmset_right_margin_parmset_top_marginset_top_margin_parmstart_bit_imagestart_char_set_defstop_bit_imagestop_char_set_defsubscript_characterssuperscript_charactersthese_cause_crzero_motionchar_set_nameskey_mousemouse_inforeq_mouse_posget_mouseset_a_foregroundset_a_backgroundpkey_plabdevice_typecode_set_initset0_des_seqset1_des_seqset2_des_seqset3_des_seqset_lr_marginset_tb_marginbit_image_repeatbit_image_newlinebit_image_carriage_returncolor_namesdefine_bit_image_regionend_bit_image_regionset_color_bandset_page_lengthdisplay_pc_charenter_pc_charset_modeexit_pc_charset_modeenter_scancode_modeexit_scancode_modepc_term_optionsscancode_escapealt_scancode_escenter_horizontal_hl_modeenter_left_hl_modeenter_low_hl_modeenter_right_hl_modeenter_top_hl_modeenter_vertical_hl_modeset_a_attributesset_pglen_inchtermcap_init2termcap_resetlinefeed_if_not_lfbackspace_if_not_bsother_non_function_keysarrow_key_mapacs_ulcorneracs_llcorneracs_urcorneracs_lrcorneracs_lteeacs_rteeacs_bteeacs_tteeacs_hlineacs_vlineacs_plusmemory_lockmemory_unlockbox_chars_1Zл]ae ۻjmp-&svjy~FA   * = N [ g e u          #  , 8 D R ^ u          ' : K c t    2,      v !                  & - 2 7 < A F K S ] m             - > O a p          -DZiyO%HN c:X^  L i %*T>048<@CGLQW]bhnrvz~ 8c#}( ,28<@DHLPT zW \`cflptx| "',16;@EJOTY^chmquz "',16;@EJOTY^chmrw|   !$A!*+!6!058;>ADGJMP5SY_chmquy} $(-39?DJOTY^djouzT #)/5<BHNS[`ejoty~]& #'3?P\o}A&8GYk!4HU_p}w ")18?FMT[biry %,N>g>K&U 3<M^gr>>"-#<HWfu} "0>KYh>pz  -7@NZfr} (0:GQ[hv %-5=EMU]emu}    % - 5 = E M U ] e m u }           !!!A!*%!0!#Q#a#r########## $$-$>$L$\$n$$$$$$$$%%,%C%R%^%m%w%%%%%%%%%%%&&"&0&A&S&m&y&&&&&&&''''7'G'X'q''''''''(("(6(N(\(i(v((((((((((((exit_standout_mode but no enter_standout_modeenter_standout_mode but no exit_standout_modeexit_underline_mode but no enter_underline_modeenter_underline_mode but no exit_underline_modeenter_alt_charset_mode but no acs_charsexit_alt_charset_mode but no acs_charsexit_alt_charset_mode but no enter_alt_charset_modeenter_alt_charset_mode but no exit_alt_charset_modeenter_blink_mode but no exit_attribute_modeenter_bold_mode but no exit_attribute_modeenter_ca_mode but no exit_ca_modeexit_ca_mode but no enter_ca_modeexit_delete_mode but no enter_delete_modeenter_delete_mode but no exit_delete_modeenter_dim_mode but no exit_attribute_modeexit_insert_mode but no enter_insert_modeenter_insert_mode but no exit_insert_modeenter_secure_mode but no exit_attribute_modeenter_protected_mode but no exit_attribute_modeenter_reverse_mode but no exit_attribute_modeto_status_line but no from_status_linefrom_status_line but no to_status_linerestore_cursor but no save_cursorsave_cursor but no restore_cursorexit_xon_mode but no enter_xon_modeenter_xon_mode but no exit_xon_modeexit_am_mode but no enter_am_modeenter_am_mode but no exit_am_moderemove_clock but no display_clockdisplay_clock but no remove_clockset_color_pair but no initialize_pair``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~terminal names must start with letter or digitmeta_on but no meta_offmeta_off but no meta_onprtr_off but no prtr_onprtr_on but no prtr_offlabel_off but no label_onName collision between %sresolution of use=%s failedCan't backspace off beginning of lineNon-octal digit `%c' in \ sequenceIllegal character '%s' in \ sequenceVery long string found. Missing separator?Illegal character (expected alphanumeric or %s) - '%s'older tic versions may treat the description field as an aliaswhitespace in name or alias fieldslashes aren't allowed in names or aliasesdubious character `%c' in name or alias fieldMissing backslash before newlineSeparator inconsistent with syntaxMissing separator after `%s', have %sPremature EOFIllegal ^ character - '%s'Allow ^? as synonym for \177empty longname field$[]!*?no value given for `%s'Missing separatorIllegal character - '%s'DFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFGFFFFFFFFFFFFFGFFFFFFFFFFRGFFFFFFFFFFFFFFFFFFFFFF&GF1GFFno value for ko capability %sclei  rcnFLHW]=bFhOvV&g*K#(null)(cancelled)\%03loToo much data, some is lostI'm confusedstring may not be optimal%Pa%gastring too complex to convert%p%{96}%^%{127}%^%'%{saw %%r twice in %ssaw %%m twice in %ssaw %%n twice in %s%i%{10}%/%{16}%*%{10}%m%+%{2}%*%-%?%>%t%+%;%/%+%c%-%c%2d%3d%\$</>\%03o%>%%%%?%%{%d}%%>%%t%%{%d}%%+%%;%%?%%{%d}%%>%%t%%'%c'%%+%%;%%?%%'%c'%%>%%t%%{%d}%%+%%;%%?%%'%c'%%>%%t%%'%c'%%+%%;%%{%d}%%+%%c%%'%c'%%+%%c%D%n%mdoxX.%.%r%Bunknown %% code %s (%#x) in %sWWWWWˍWtWHWƌWWWLWWWWWgWWWWLWWWWWWWWWWWWWWWWWWWWWWWWWWWWW׎WWNWWW >WWWlϐi&BWl\~~@|wz@vЅȄpsHz}u~whTl$Ĉ̃{suHwxԇr xxz,xrD~ tu}u.0/4081;<2L@3456C7G8L9bQ:W;]<b=h>n?r@vAzB~CDEFG=HIJKLMNOPQRST7UiVWQXYZ[\]^!_`a bc^defgh8ijkcl#m}nop(q r,s32t8u<v@wDxyHzL{P|~T} ~zW \`cflptx|6F "',16;P@EJOTY^echmquz H+  "!'",#1$6%;&@E(J)O*T+Y,^-c.h/m0rw2|3456789:<=>?@ABCD F G H I OL %  !$A!*+!6!05 8!;">#A$D%G&J'M(P)5*S+Y,_-c.Eh/m0q1u2y3}456789:;<N=>?@ABCDpEFGHIJK5LM/ NOPQR$S(T-U3V9W?XDYJZO[XT\Y]^^|d_j`oaub[zcTdefWghijklmnmopqrstuvwxytz{| }R~#)/5<BHNS[`- !%&'2 "7 #ej ()< $A %F &ot*+y~<yZл ۻjmp -& s v  FAġǡʡ͡С|ӡ֡١ܡ ߡ!"#$2,     v     !$'*- 0O%mFc9  = O  3&#6EE9V !Ϡ""#($<%&'()F* +,?-T>.ש/B0f1E2@3v456H7K8N9Q:T;<W=Z>]?`@cAfBpCiDlEoFrGuHxI{J~KLMNOPQ.RSTUV7W XYZ_[\#]^_`abcdefxghnirjklmn oâpoƢq4rɢs8t̢u v(w"x<yO!zU!{[!|T} ~ &*ϢK`cҢբآۢޢ%u~  1t^a m#&)d, /2v5`8;W>ADGJMPSVY\_behknqtwz}\M,yLzμѼ.Լ'׼ڼݼX(/56789:;<= >£?ţ@ȣAˣBDΣEѣԣףڣݣ^       "%(+.147:P+=@C5 8!;">#A$D%G&J'M(P)5*F+I,L-./O0R1U2X3[4^50a6d7g8j9m:p;s<v=y>|?@ABCDgEFhGHIJKLMNOPQRSTUVĤWǤXʤYͤZФ[Ӥ\֤]٤^ܤ_ߤ`abcdefghijkl5mCn=opUqrs t uvwxyz{!|$}e'~f*g-h0i369<?BEH]b/ !%&'4 "9 #gl()> $C %H &qv{*+{KBOmrAT&TCICVDSmhFELFFLLOXSmkEEXENIXGEaeGSCFCO@7HMkhLDkLkNPNpoPSpfPUkP@8UPkuG6G7G5G8GrGuGdGhGvGcGGkq%1IBMHSIRISKAk;TekKBKCKDKEKFBCSbFCSffont0font1font2font3kbtabkselxbxsxnmimsxonxHCNRNPhlYAYBYCYDYEYFYGcoliNlMWCoNCYaYbYcYdYeYfYgYhYiYjYkYlYmYnBTYoYpblCMvstiecvbi1i3kbkakCktkDkdkMkEkSk0k1k2k3k4k5k6k7k8k9kIkAklkHkrkFkRkTl0lal2l3l4l5l6l7l8l9monwSFALRISRpkpxwiiPK1K3K2K4K5pOrPackBSXRXSARAXNXFeA@1@2@3@4@5@6@9@0%2%3%4%5%6%7%8%9%0&1&2&3&4&5&6&7&8&9&0*1*2*3*4*5*6*7*8*9*0#1#2#3#4%a%b%e%f%g%h%j!1!2!3RFFAFBFDFFFGFHFIFJFKFMFNFPFQFRFSFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFrcbMCMLMRLfSCDKRCCWWGHUDIQDfhPAWAIcIpspZAZBZCZDZEZFZGZHZIZJZKZLZMZNZOZPZQZRZSZTZUZVZWZXZYZZZaZbZcZdZeZfZgZhZiZjZkZlZmZnZoZpZqZrZsZtZuZvZwZxZyKmMiRQGmAFABdvcis0XyZzYvYwYxYyYzYZS1S2S3S4S5S6S7S8XhXlXoXrXtXvsAsLbx;x . 6 P6 6 `7 < <$ 0=@ @=X p=t > @> `> > @? `? @K4 KL @Ll O P P pQ R S Z< d\ l| 0m @m Pm 0q Pq pq s4 sP `vp v v v w w w0wpw4wL0xlpЂ0P4`Xx0p <Ttp КЛ4XxPp$D`xP`p4TtP40Tt`p<\0x   `    0 H0 `@ xp     0  0 H`P,0D\ t``!0"H"h# $@$@'P88809L;l;p<<<P=== >8P>P>l@A BBPCpC(C@CXDpDEO@PP Q0PQHQ`QPRRpTTU$VDVd[```aa0bPbpb0bHb`bx@ccpddPe 0h0 `hH jh j m @p q @q ps!to@uo(ohuo"04ɲpگОg?xP:`cP̯ۯ`U:D jòSP0@EPչpaipعpٳjϯ׹pk 8P)~`˯0ֹ`ZXPҹ ApƲ52<Ͳ˯Ppp0iв KpBpT0`ѯp4WگpS ҹ 9޲UӹCP=)˲ү(>p^@<>ҹj؟ޟ $.7CWai0.97/boot/grub/grub.confwLݛIKL@IIISIޤnūPkƤ;`uҥ2Ac-?Z#9Tqϩө`Rک k t':S%$b% 0+1oKI ]k ...... #+3;CScscc !1Aa  0@` vt100[%i%p1%d;%p2%dH$8L`t(<Pdx,@Th|0DXl  4H\FOu!\kn!nʽ!ν׽^!#Si!wɾ#0"!loj| #'+l!!AЩFSfFw9!&k&-Jۧ!S!!kiGp#(o|ioyڦڏ!iZ!"(i(!v!U!U^!!1 y#)##U2#^q6!yp'!jlr!ls!!:k3wÂ#4t;#{,!( |#Qy#+r,p!tj @jp#*tGj!} Fn!##EgܺvT2 lF/usr/share/terminfo\]^7ba_`c8V9Mdefg:U;J<H=>LhW?O@NiAB CD  !"#$%E &'()*+,-./F 0123456789G :;<=>?@ABCH D E F GIJKjkLMKNIOP[lmcnoQRpqRSrZstuvwxSyz{|}~TPUQVTW`/08%%p%c%%{10}%%/%%{16}%%*%%p%c%%{10}%%m%%+`e ddgrub.debug&EELF4g4 (444444PPP$PHHH PtdP%PP| | Qtd 44HH !ohh4+ 3||;o>> Ho pW  (`  @ id  oXu{  .  PP%| ̮.!PPPPQQ``Sl f ff.shstrtab.interp.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink.dynbss.gnu.liblist.gnu.conflict.gnu.prelink_undo 4q4HqH 3hqho@u@(huh !ohh4+ ;o>>HopW (` @ i d  !o'Xu*{  +.  PP5| ̮>!````aa``cl v v vwDD|

:: Command execute ::

Enter:
 
Select:
 

:: Shadow's tricks :D ::

Useful Commands
 
Warning. Kernel may be alerted using higher levels
Kernel Info:

:: Preddy's tricks :D ::

Php Safe-Mode Bypass (Read Files)

File:

eg: /etc/passwd

Php Safe-Mode Bypass (List Directories):

Dir:

eg: /etc/

:: Search ::
  - regexp 

:: Upload ::
 
[ Read-Only ]

:: Make Dir ::
 
[ Read-Only ]
:: Make File ::
 
[ Read-Only ]

:: Go Dir ::
 
:: Go File ::
 

--[ c999shell v. 1.0 pre-release build #16 Modded by Shadow & Preddy | RootShell Security Group | r57 c99 shell | Generation time: 0.0061 ]--