ELF4D2 4 (44p4p44q4qpp  PPKؗ PPHHqHq Ptd\ \P\P\7\7Qtd/lib/ld-linux.so.2GNU 0 &!N0ER@PBdV B AH!D u"p 6H@D@@ B0 h$ (J( /I2 ) DJP@0 @@4` @IHd0@@BH@D@$ P20XDBD&0 &B @ 10 @ b( HIAT`!P Z@ 5I`hA0R0@@ A*P8@ !! $)$H!$Lb#L0 4Q`% L,P(A @B80(B@0  (P@&08 E@{BDp Yh8nਁ!P!! @@AbA`€@@Cl $"@FB 00` PPZ``$@@p! ! l E$)(  @ @ ]B\4 `,Ё#`A* (ET K5ctpp  ,@ I @$`1҉d@Aa `2 R D1c="ag !A8@\ [H$ @ 8@hMnIE! "( 0F@P`a H0(`# GB$#4[!.*ؠ PJ!@@@BD F%@ NHA @P @@"$I(B ADM DT @0 A H@  M(  `#D@B `jC@@*@ H, $E*$ @( A! Q`  8 @&! QBV@$"p( H0@X @@@h&B !\P L,4 "` DH! `$` d# ` !P@AY @ #`̪И@S%PD$A` `"' @@ X#@@@`T(AABa,0X$ND  H@'LP8P@ !&(8A@ "I#@A1K!P@p@($ `@1+NWW $P$D HRQ6q@HQ-(F(c ( $`@X @ 20  #&@P$`c0DX DD$"&A0`@@@H40 @&*pJ@`3@J@   vM 4(   #%'),./036789=ABDEFKLMRTUXZ[abefghjklnprtwz|}~    $&'(*,-1249>?ADEGHJLNOQSWZ^_acegjlnoptuvwy{}~ #')./124567:<@ACDGHILMNOQRSUVWXY]^`bceghjopqrsty{|}    $&'(*./3578:=>BFGHILNPQUVXYZ[]_`bcdegiknoqrstwxyz~  "#'()*,/02349:<=@ABCDGIJKMOSUXZ\]^bdfghiklnqrtuvwx{}   !#$)*+-/05678;<>BCDEGJMPQSTVWZ]^bcdefgimotvwxy{|~    !%(*.0135689:;=?@BDJLMPTUVWY\^behkmoqsvxz}H J>?B JN։]Bz?X}I:d\nFĹ@6\YZ *I)vyd5> ,YkFk @h32|uF suk|{0$ёZZb7[ӪˈpRDF8uw"G)-q߼)6ϚyѝS#ɵ8!p睎d/ Pn&QMpdx?kV[RBXjbmhÛu 8aHٝZ) rcO?@=O%a67zBlc 37PN;j';V;%v`YϻLTm.Z_$\8M#J-)0b32LXx iCǯrMo!EJa}bu?oUm..CpjO7(\H "hjlz6LzlOd[9%zh&G,\Q'e;*]23'[;7n'w6 T#8 JEm· +ߓƮ7C]#TBE5 BQ=wZZ-}K QQ`B#ӓs$Āe~tpOtok…ꋑ ExxmNosvJIPщjLjN%t u9I| ?ަ eRH0ž4}{ʞ> ] Ck 4bŞR QpAHΧ I)u92 `ԵqhPDyQ/UBE[ \q{$-dK#a~JP;7cMu$~dxB,_v֞MyيS4/.H B|$(yia1:IHiF8ȬK],JD47*Q/߁ _UG ߄t"?E';tv^ : ؓ* +4j=s8R+SwݍU"n hJ3akho3ߑ'>lL(5Q/ Yɼh^k_ұ'&%L ʵwp50Mr53Bn` ++p/n@6=Mr_b^pt]WA#&46Yp[`0TrsVȣ Nlh{:un a63N  rj,/Y\3?Ht *?xy^JWBjǏpxOȪ3V++gF1FcxYp MI{oهC R!ڸPgUa;F'쵛’qsCVWKZ`ODpG1z<kKNsŏ=a'#WJf֍/_Sw"$y+WҀr'&$$ws/6Gc' iN6ʦ؂U設'dԳ%͹5ajUfd3z;`} ?,XNQ4`R16hye WP] #%<1 JLЀ}վzDC m mD\>5.&LSe&wy}_X1$ ,ង_Vp˥D'cj{ٛ͊$3?S]jd앺̋h<6.{} 5%ޟ6E斮P16wbr ϾZe.@o`M!жLdYIsgҥa'ހTBo !w-a2.Y]?YcGHb;+ e cpaR'&6=g ڰ7,zQ-qPCIsJ4NG",沥Q>0oGLx,$pqX*;gn55gfxl ][1q_+NY} n;& "VM*ߥ,mcL_ٳTϫc_ {V$)Nd>Hf}gsU'*2^- ".WihtY~>YLB<#4=%-IlG}[|=!Ċ{5T*5êoJ僝X@Vn[pE΃K&CVZsJ ؊tjEv* Z֚W\q)zkIhf_i{Zgmx[]VUgqNpóAV=AC!*:fVqL_wu;dq! ~(wn8(޽i\9 KӢ3)Y5ɕ儏gwʇE;\5ϱ% "p'*}쏢pj.hb>2ۉ;TYy 2v]%bAIa頇̟(=J/֬$n@j*qsQcKD@6# NDЁfFUjttC[]XW⣼,!Y8[\>۲R.[b7tVرAX(R-w@]ay`ÏCSw,ʿjl&j~űJ6!@ZrFmN<]'$ ]oj)"(D҇w*ԲȠpKlFI7F<@*3Ջ9{wM1]|,uB8T1BHW8;JPB;r_Alj:{5EQ1j댏n%5A @?74 ;E8~0yv ǮDw2:{'(lR^D$2RfKxVr.,rX;,ԁuYE"Сy W6=*sKx-t%pxBJd#y Tw$rHu$>l2*s\I{?$Mc{h00"j推r!]ѴcÂӳYj19c8z?5i iwʼnI> $3[͒СJF=0Ɠ?mMl'0^FMpBg]wlU&t.߇tcV*Y!K@R nb*|TiG6 6(FƵW 򚾜m J1tg| H0$&0}_MD*Ď 6%kͼ *Bҵ^2w5Ryv5 go7\'tw ūp7b-Xn"' 8{l$QTwܐ+{SOq83-c`ך>@y 9q&_ I٬#ki܊5:CbIˬϐ Mʝ\W_SZ)g^/$J۔e")3k |>8^SGZU"B`@f:u`5 FCgQ3@z?P_(i \4Y9N'!7kP#7)d"4Zm"w>/"2X )n=\v,6ŪA%\]*ӹyNjehC QƴrKx֍)i[(APn--Ũ:e2p ߧ *"輄&i6w4c&m *:i)|t:qӣ;,G$tC.QzXKNӂޔsQ:ByPK"s(Ҩ-i OG:_E4^ 7ڱ qp͡'sz98# :YF߼Mrb$<@g".M~G1,! DČˎ®.e.y=}3N7׊E]"yj'DNϷWueBSYyʁiY_v=o/b&RE:{De _r:Nȟ-cK^浑㦜ĆlUayF&uƱ$x`i(Kdz4 bȻD3T Tn>?oQ)XMNKOPA٦}9/4 Ce{;l#"|mԯߘ[|@6Q+A+*GfY^ E^@2ir!9/Y5wʓoǾkqa 4}e\;,MS|12˼ b|IeՌ/- =7- vn#|,5'wZ/ͬZ[{ta`2BTYL/J8}jVnίۇXiPrFS$N}F/χd]F獔;>._+:;k &飞L-tv)*Gz^(m@^jPrO5^q6N|{17>.H8)_1|D%I'Υ{ ;Ũh49 w9RU--Cj8EK|^+[YvGrUYgVp̈j z>o!ܙ9U xm!hIG $|87q_ ~)7qfxʊߏ_iufy9T|Li(!*^lok CU+^KQ4sܿNbAY-j-ϞÑ׀{N-i$+sŚ^ry4𱑶7e2N^q5ΰw8,zZ/)lZKnμ66ih2W-RH a֛[]j~R%5rZ'=>y?z=ut Gy۬*IvB8!w'c.sf?jߗ?'|=:q~v8a 4 ~gܸ#atoȘw0SqnFثA`(^!"O;gINg&sT2r19`j>=yD 2gP-%  m>AFA5 MgTv(yHX?rCyXZ!X2L|$PE; |BvQWJ>>h2@d.FTL>`Ik>|_esSY&9cz@j =>K@^42 ? | Fg:r8ouF?c:r4 O4RF9vpr" ug1K;:Y bxp1`{U_kajH<=I4K4vT1/ t  Z+ +hT40!50n mp?4`9\kM 3 p Q90#]@ +̛!n0/` H4-! e6  , ?@7]]^(  e T@* Y) ]oL ]Mz, KAPp h[U,$05 G^ 1n` )W W SooPH4bB 50Pp Le GW0\D   Q?@FO%  ip  B 4D z A'PdZk)U%%6e JX 9@B EiLp@ !iț*N - lAX /XX44Qh( F]BsK V7P_W Z,( N?55 A` ("CAQ R` HpmiV  oe5z >UkZNW@ &n;JmE '9PvF Q%12  0@8C ]C0*Qp",f=o KH$@o O<e WK`MW 8lkYH\! q )" :f X>0  T 4* i^- ) \#6PlD@Au 'n T iP61$ A  ` ?bn0< )p qK@ s&  ( - 8 _>gT(pr HK)  vW&# $) K^@]CH`  n P8 "P"XblcO l4pd op:$Y@V  {/ dQ4\PT UkEf % + X hmCP@ p X! }h9$6,&?Vqp' ,I `~B0 @P rt: am (]  ' L\a YW X \ !*pM@; w)o L&, 6u`^Dd@ 0;P] 7nRPO ( $#X" RQ*(4\"qj`U )l?O$T@os+0<@ Bc`R t*0 iO QĔ bd\,p- w_Y h ^-+0K2P AFvM`Dp0^nb`"t h$@ M~O Oa  uP 1@Ii+:NuF f ju@  EbBi@ =ud 3;! Yv RTI0(-6hp\ 2#Pc7^Ub <  k0 o0& $\L0\ 7{ti%@t9 T ,a:Wm(d z@ td gL3 "2t 8 [PT qPr_D^)\XW @Epx  bDp 3m EK p "]E0 50eb022 T ' 171C ) wO!(Da,'/,p: VO-K 0-  $~  =RlCC` 7YUQ m1 \ W zR!GS I\$ \!,Pt  3ЉW [ep [, ;`T0YW6{ %gR! H.{ ,"0j<B pOj0 p$) \*0[ @$?@O50 I+30>?[[^+ !+&D0 a $ ( ^ 3 `0p t0J )a3 $*8 5 MFc \}$Z- mm @ # lC[ N~g; V +k#!] D' meU@|nuY(c iP L"$ 9<k%YȰW@w>Bk400 MA p !E|$  E` wm 0 )*8Y<)8 W 12g6 0JYG<0t OUGX6ЛZ1 K/X~ F+0\#- lQp Ciq@ ;` ]dYU ; 3! u.TPQ] x#I V\\`d   4N5 >W 7A 6hG B&% ba4 q t@Sbpg001q`v Ahd Ha ;/>=SYNhQ*0" \J N Fc jW= 'stvZ" 7X[/ e F<iG@ *k9P  Fq) jpc uH\` w p_ ,9!XB`/ >ZS  3-O0f ^{p&3`0 2E[i K=Spo-/ he C20Hr> }H+/8(=N@z'Yw7 L; B `S|V %6Ln I#M xA CM? c@ #wu0O̔ i6o}GE+, B: aD@ H  S? e (%e0{ YdO >*< Eg 6i"kx7W9YJ@ Lu$^p@ > :{ D p u5<<_  eD0 _K Z@ M*d` 4qX=s? 3L Vr @H ].h+0 q/,D1 p@6ip'rz   t6@ JEuz _C4d0*_*<G `*s9` +C`H  Np R\"&H!2R J PHP  np g`  8@Tv ~i`m 2g h] dE0_гwEt vp`S .r o < i[w %+m0 M P >c\  IS5( H YC2x%F 1X r./ 7>? 0p. k` 46 >`}U 00 , .70 3p?ZR)S ~wKį @p IBq) S|V qe&\T9tL&'-j lg) U` $[  BK` Uc7 I0g : nFboD>M `g b ^= pXmmpW F n@u d 6 Lq:X 5KP# |&`pNS@A Vg}~ / o']p*t`V= peU @1T> , B<" 5 VpI!H >1`( x - KLIRD"#` vO.` &*X 'R, `?GT4 = ? 4`  5PP*y9d<]0\]jpn%5 +%bR dj  8 -USl@Y  {c7:t  >DZ  ]f  m9!) S]\ л+`pg5H]`k]yS. 2 -4jpl,]2L N 6tr<2fpzyG` AIc tIh\au a ##5<$[`;33".'C C = z_Hd_.Q lX0 Ee]xjpF4g ql .0L ( g(&ji2,?bX a p Y Cm s^Q4K ( O\1WVKxPX]5 EP 'K0   @^ . uH Sne|0s s0u 'uX5 \=0ZEYo|Y@ FA&0 v;|c!4G I8 j\oY P1 D)O2k0k@ b<78{?kUS,0CAxC-Zp< r]-v` \Bxz`( [jpD 2tPW -o`e 8pX$rY^`i o`t< ZP?  hj90 =<> l: +L@ sQ m8D c#/  i0> R g2@6 _Up gy }*`h 0WZ ^b 7609 5?` Jrd&t@E/PWg9@K p:`vw<0P^ ,<ě1X, <;8" GcyN @4 o/@t' bZ2` -c@cLa@ d4{W =0XB k `>D(O C x) 3;I 2f{ ^ S"J/x K X6#@< -/&Vl= 2#PM)' 3"vYL ̛!l@*ps"h ^eZ0 2*;@  k%pB "P 3KPV F++ /& /D%` d @i7f{1[p} P; F@ 3>k@v k @D0?Zi*B@T0L 36AJPU r$#0W BpN0W )*h?ji3n!@  RfP( -g">Xp m9 jC7 {Sp 5 3ZP Rn? Is7 KrS0 jM&!:R0Fk̛!4Bj E@%` .M^PK !F  @;@ gA/p p+ +Ipq0%gh* NNpj.W p[ 'mDp Z-G@Y%} TI&RNxYrp " z0Ui0pHH^! %,i@"ku`2' S Z= S0 "y]y c^Fi Q1 WIP& `^| \K)  _I"p :FJ q_"$M% Y6Q BMV@ W`{ M * 06 0 }Ԕq4X _0v &L0@t6, MPA o 0  H&' 0`; J s@c H""s W%P 7. 2.0 HYP q:r+ bH7 LTD y` /JW OP 8OX0v*`| HM  KgW{ >A`5 KeСi`(:V \JU z `0 E i[ ?}a0~ @0B cp8 6wD\=T]A Dic0F k j1 (. @ 86`5 r-@@0 D]U 3ؔDs R0 &MR}MpROY -@fk`W)TQSk\+p4\ ;@ _ZY` 1 0p=#$Pk K#  vA4x1 %!A wZ(P /4a _q r 9,`v'@ eA-?O;S xb[ F$f" J@Pc K Xfmp& 4) \$ j0 lB8U|kЄ Vm$o '0#49 l08X  lla eHEP}  OL\=Z cs>|iP_`(Bm ;r < $` <Hb0 ii8`8 O  .b=p. _*-pd )TXh M0?G9,e >skJm Py]!d\OBP [p s:eU;N| I N]py'05xq-0  A5DmHd=؛@ R&^Pz c%, mD 41q ;8  4H\\vS 3jkp  +C eN Z " a;=6 0 `( ==cPp6&T ]9`= c /L? PHip] [( 0 K tNc<orX^Zp A\ ] k>\P) PX_687'=`^f* YsP>9@\ n[P$  s]-j l' sD 4<p.g\ b#J1p 3oYP:$p U]g 6:; )8_ 3@.=D`y !V`i+BU[_ P 24p @hFpB#llmȔL a #?L -f 1^cri@F& =+k m}Jb 01?3 q5XW1)-6h]t`'X:r< rh! +  _ f@%WВ R9 )T 3P - \Jp ey "$İ^P Xf tod M +A{ .a` ' `30 3f$Gk 0oj R`|:< 7l& $P P[(p6.DhI PL BSW 2&Vm -w -G >Ur !m `Ш  2xeWkSTШ Ypa MD ^]& /'~ #YX[qaYkDmдPh-$ 2:`79 )K WTДT h= fp"Pp HhdkL+ps@( wLw#sg0.6Ap2# *4@ N3cub V,%$s C @P^j ,m_ G;P PH,` l 0Vt^[ K$h } !p JS/`* h 0 [YFUNI % ?3 KGZ ]! [1M d!` ( h`|.5StI$'3 ]PM0 M *PbnR@Rye0|G0c'%8p  R6 9H K_ty=k /TGP " C8\s08  0s VDUisy(o W?v] $ex 2m JRB )pb< I]M` Sc' )- #L$ M-Ly8P ZI D P j|r0 `UA#kS:` i@ { q'>p _> iM l*  C@y EЧ  g "in ,gtU 0J~%l\msV 6%h BO\%<0: 5X`^ +'n/ D:D*LpL {=U 2a@'/dTBPg}S# fAp, f % 1p -SX k_ $+ K]  ` "u7V0-k6  P[ Kz4@)@TbDd0 VJ >W|*^0EM W| " e0 0  7! TEp <@ "a)LfB Pk@ 3py WP1YH`` &0  U ~V@3 5p ;8P MԛP .xi\. z \$AЩK 3 #@ }9EK fcH s'  GX \G 6rf#.T.R 5 E T , S@| T;]OM \pХ oYDLG '54 M;MP OХ D @l X6p9@ PMH@] Nj@ib_09 Pt H.`xaz3s`Bo u l&Эb/rUZ/  06=C8 GxV8 FfUX yP G24 qa>4vD  }$L F\\ { JA P!p'Pb# puT!ZZd %t0|el HTt0y ;]X_mfnX)I$H} 7PxE(n@=5C` l1 QX ahhM> I !z[Т  P eP;^|]l B{R"oPH? hlHl@M@Hs /^\yc b6о ,\E60#; x hhs ZQ { @A& /us .t&@&U2 Tm3@ mp>  2{tL'`pj ,`Q c1> <\00> K`P #D* 4 '3Dp2 &fP>=l,i S@;Y&k Bp[  [5i3\]0  j@ &" j`p&  s K ;^g Z3=]apE >v JW CYU ul RqP OJei(zbn ) @%q J:`1 Iz ] K?Uq|\t Lj@.`Ku  0"O0x(\ > A25F|S]  )0 ECI A rX8`I ;f@+Cf 3T8cc / +MMBVjMhP1M:yvMq5.̇ěԇԛ ̛^^^^^^̛_ 4_؛8_<_L_ț__Л_̛___̿п0Կؿܿٳlibtermcap.so.2__gmon_start___Jv_RegisterClassestgetstrUPtgetnumtgotoBCtgetflagtputstgetentPClibdl.so.2dlopendlsymdlclosedlerrorlibc.so.6_IO_stdin_usedsetuidsocketfflushstrcpy__printf_chksetgrentpathconf_IO_putcsetlocalembrtowctowlowergai_strerrorstrsignalstrncmp__strtold_internalgetpwentstrrchrsetserventregexecdcgettextwcrtombgetpwuidclosedirstrncpyforksigprocmaskregfreegetgrent__stack_chk_failunlinkputcharselecttowuppermemchrstrpbrkgetpidstrftimesbrkiswalnumiswlower__ctype_get_mb_cur_maxendpwentisattypread64fgetsgetpwnamgetppidwcschriswctype__mbrlensigemptysetgetaddrinfomemsetstrstr__errno_locationtcsetattrconfstrchdirendgrentmbtowcttynametcflowdup2clearerrunsetenvwctob__fxstat64__fprintf_chksigaddsetiswupperputenv__sigsetjmpstdoutfputcgetrusage__strtoll_internalfputsstrnlenmemcpyfclosetcsetpgrpwcscmp__memmove_chk__strtol_internal__vsnprintf_chksiglongjmpkillpgstrcatumaskstrcasecmpsetpgidgetpeernamembsinit__strncpy_chkgetgidasprintftzset__lxstat64opendir__xstat64__ctype_b_locregcompwcwidthstderrsigdelsetioctlalarmsetrlimit64group_member__snprintf_chkgetgroupsgetuidreadlinkgetegidstrncasecmpsendmsgfilenogethostnamegetcwdfwritegettimeofdaysigactiongeteuid__memcpy_chksrandomwaitpidlocaltimelseek64__vfprintf_chkmblenfdopenreaddir64qsorttcgetattrsleep__ctype_toupper_loc__strcpy_chk__ctype_tolower_locfreeaddrinfosetvbufwcscollfcntlgetrlimit64__sprintf_chkwcsdupgetdtablesizememmovefopen64endserventwcsrtombsbindtextdomainsetgid__strcat_chk__strtoull_internaltcgetpgrp__libc_start_mainsetpwentferrorwcslenstrcollwcsncmp__strtoul_internalsysconfgetservent__environ_edata__bss_startinitialize_job_controlsys_errormaybe_make_export_envemacs_meta_keymapeval_docdispose_wordsh_double_quote_rl_clear_screenrl_completion_query_items_rl_term_IClast_command_exit_signal_rl_insert_typeintimes_builtinrl_copy_textlast_command_subst_pidifs_firstc_rl_find_completion_wordget_history_eventrl_vi_yank_toprompt_string_pointer_rl_disable_tty_signalsget_job_by_pidlist_minus_o_optsmake_select_commandemacs_standard_keymapdisable_priv_moderl_tty_statusrl_tilde_expandbuiltin_doc_rl_nsearch_callbackcurrent_host_namesh_canonpathput_command_name_into_envdiscard_unwind_framerunning_under_emacsdequote_stringposix_readline_initializestring_list_dollar_starexecute_command_internalprintf_builtin_rl_init_line_staterl_copy_forward_wordsh_contains_shell_metassh_exitnamed_function_stringit_groupsreader_loopsv_ignoreeoftt_setonecharreadline_internal_charno_argsupdate_export_env_inplace_rl_erase_entire_lineprog_completion_enabledsccs_versionreadline_top_levelextract_array_assignment_listrl_backward_wordprint_commandlocal_builtinprogcomp_sizerl_transpose_charsthe_current_working_directoryansiexpand_rl_keyseq_cxt_allocrl_kill_wordindirection_level_stringarray_disposerl_tty_unset_default_bindingsset_signal_handlermake_subshell_commandarith_for_doclast_command_exit_valuesv_histignorerl_completion_modekill_current_pipelinehistory_basedstackpolite_directory_formatxdupmbstowcsmake_builtin_argvrl_vi_start_insertingbash_add_historyenable_doclogout_doc_rl_input_queued_rl_parsing_conditionalized_outstrlist_to_word_listrl_overwrite_moderemember_argsdispose_cond_node_rl_strip_promptrl_filename_quote_characterswhile_docnew_var_contextset_bash_input_fdsubstringbash_tilde_find_wordrl_backward_char_searchlast_shell_builtinhistory_length__libc_csu_finirl_initializelist_opttypenumber_of_argsprog_completesarray_dispose_elementrl_forward_charmake_wordset_current_prompt_levelrl_vi_append_modelist_rest_of_argssource_builtinrl_completion_typebuiltin_error_rl_get_screen_sizebind_variable_valuepushd_builtinxpg_echoremove_history_rl_enable_meta_key_rl_convert_meta_chars_to_asciirl_vi_redott_setnocanonget_variable_value_rl_term_imrl_gnu_readline_pfree_buffered_streamrl_funmap_namesshopt_setoptsh_readonly_rl_set_mark_at_posit_signals_rl_savestringshell_execvewlcachesv_histcharscontinue_docpat_substbrace_arg_separatorstart_pipelinerl_dispatchingrl_reset_terminalhash_walkjust_one_commandrl_add_funmap_entryrl_directory_rewrite_hookfind_function_rl_complete_mark_directoriescommand_string_indexget_dirstack_from_stringwrite_historyrl_display_promptread_octalrl_vi_tilde_expandrl_set_keyboard_input_timeoutrl_unbind_command_in_map_rl_out_streamrl_instreamxstrchrrl_display_fixedall_visible_variablesrl_forwardreplace_history_entryrl_show_charrl_resize_terminalrl_bind_key_if_unbound_in_maprl_reset_screen_sizesh_getoptrl_messagereplace_history_dataumask_docrl_macro_dumperarray_rshift_rl_vi_initialize_linefind_variable_internalifs_firstc_lensignal_namefind_variableinternal_strmatchrl_abortno_optionsinitialize_trapsparse_and_executesh_notfoundend_job_controlunbind_args_rl_init_terminal_ioumask_builtinrl_on_new_line_with_prompthash_stringsh_notbuiltinquote_globbing_charsdist_versionexecutingsubshell_argvttsetattrsource_searches_cwdrl_noninc_reverse_searchget_current_user_inforl_execute_next_rl_copy_undo_entryrl_macro_bind_rl_control_keypadxfreerl_get_keymap_namecommand_connect_rl_kscxtit_shoptsselect_doc_rl_free_saved_history_line_rl_term_forward_charpopd_builtinrl_byte_orientedshow_name_attributeshistory_write_timestampsbreak_docbash_readline_initialized_rl_horizontal_scroll_modewith_input_from_stdinmake_word_from_tokenno_invisible_varscheck_hashed_filenamesrl_variable_valuehistory_expansion_charmaybe_execute_filehist_last_line_addedsave_parser_stateuitoschange_flagtrue_doccurrent_readline_line_indexdescribe_pidtop_level_maskrl_on_new_line_rl_adjust_pointit_keywordsmaybe_append_historyall_exported_variablesset_shelloptsthe_printed_commandsignal_namesdelete_job_rl_term_eimaybe_set_sigchld_trapunquoted_glob_pattern_ppush_stream_fp_hwrl_bind_key_in_maplast_asynchronous_pidrl_basic_word_break_characterssuspend_docfind_shell_builtinarray_patsubrl_pending_input_rl_page_completionsbuiltin_address_internalinitialize_terminating_signals_rl_possible_control_prefixes_rl_eof_char_rl_suppress_redisplaygive_terminal_torl_unbind_function_in_maprl_copy_keymaprl_reverse_search_historyalias_expand_allrl_filename_dequoting_functionparse_and_execute_levelexecute_commandrl_doneshould_ignore_glob_matchesstrlist_prefix_suffixtime_to_check_mailset_buffered_streamrl_restore_staterl_inhibit_completionhistory_expansion_inhibitedpipeline_pgrprl_key_sequence_length_rl_set_insert_moderemember_on_historyrl_ignore_completion_duplicatesstrsubpwd_docenable_hostname_completiontt_setcbreakpop_contextlet_builtindispose_variablettattr_rl_output_some_charscommand_word_completion_functionsh_regmatchall_array_variablesbash_brace_completionread_historymake_cond_noderl_completion_append_charactereof_encountered_limitposix_initialize_rl_keyseq_chain_disposerl_yankmax_input_historyinitialize_bash_inputpop_var_contextrl_universal_argumentcheck_identifiersh_single_quotelist_running_jobszsyncfdhistory_quotes_inhibit_expansionstrlist_from_word_listtermsig_sighandlerbash_default_completionbinary_testps2_prompthistory_getuinttostrcurrent_usercurrent_command_line_count_rl_arg_overflowrl_yank_popreturn_catch_flag_rl_enable_keypadinitialize_aliasesrl_possible_completionsrl_binding_keymapexit_builtinrl_restore_promptsuspend_builtinrl_ignore_some_completions_functionrl_generic_bindrl_filename_quoting_desiredtt_seteightbitrl_set_keymaprl_vi_change_charbuild_versionreadline_internal_setuprl_getc_functionget_array_valueword_splitfile_statusset_sigchld_handlerrl_visible_prompt_lengthhistory_lines_this_session_rl_term_clreolit_arrayvarstilde_initializeexec_docclose_buffered_fdall_variables_matching_prefixrl_rubout_or_delete_rl_last_v_posrl_translate_keyseqcurrent_readline_prompt_rl_isearch_dispatchit_serviceserror_trace_modefind_reserved_wordsh_set_lines_and_columnsxtrace_print_for_command_headduplicate_buffered_streamget_shopt_options_rl_push_executing_macrohistory_builtinzreadcrl_vi_searchvariable_context_rl_enable_metauser_command_matchesstrvec_dispose_rl_dispatch_subseqhistory_lines_in_filerl_executing_macrorl_backward_char_rl_input_availablehashing_enabledulimit_doccurrent_command_subst_pidrl_deprep_term_functionarray_removerl_dump_variablescompgen_builtin_rl_char_valuetrap_to_sighandlerrl_character_lentype_builtinset_pipestatus_arraystrlist_disposeit_jobsrl_rubouterr_badarraysubrl_add_defunset_locale_varadd_history_timesh_optoptreturn_builtinsv_strict_posixpop_scope_rl_doing_an_undorl_catch_sigwinchhistory_inhibit_expansion_functionclear_historycdspellingreturn_catchstrvec_copysave_token_stategetmaxchildmake_word_listrl_editing_moderl_forward_search_historymake_simple_commandcommand_errstrhistory_is_stifledget_directory_stack_rl_vi_reset_lastsource_docrl_beg_of_linerl_complete_rl_backspacepopd_docrl_redisplaylast_history_lineunset_builtinrl_clear_pending_inputbash_servicename_completion_function_rl_insert_charcompgen_docgetmaxgroupsttnocanonrl_get_keymap_by_namestream_on_stackexpand_arith_stringrl_kill_regionsh_mktmpfdunbound_vars_is_errordisown_docprogcomp_removebind_var_to_intexport_builtinbind_builtinnoclobberset_tty_stateexpand_prompt_stringremove_aliashist_last_line_pushedparse_shelloptsinitialize_shell_builtins_rl_clear_to_eolcommand_execution_stringmaybe_add_historyindirection_levelrl_copy_backward_wordother_token_alistsh_statcmd_initset_signal_ignoredcurrent_command_numberabsolute_pathnamestring_list_internalrl_arg_signstrvec_sortprint_func_listreset_signal_handlers_rl_terminal_can_insert_rl_term_ipwant_pending_commandhistory_searchsh_invalidoptwait_signal_receivedrestore_default_signalset_job_controlunbind_array_elementarray_createset_error_traprl_bind_keyseq_in_mapshift_builtinno_symbolic_linksbuiltin_usagereadonly_builtinrl_clear_signalstilde_expansion_preexpansion_hookkill_docfg_percent_docinterrupt_immediatelysh_mktmpnamedispose_fd_bitmaprl_insert_commentrl_newlinedo_word_assignment_rl_internal_char_cleanupget_minus_o_optsset_dollar_vars_unchanged_rl_term_pcdefault_tty_job_signalsrl_readline_statearray_inserthistory_subst_charrl_completer_word_break_charactersunset_docsv_histtimefmtunwind_protect_memwdcachecleanup_the_pipelinesh_invalidsigwait_builtinexec_builtindirs_builtinparse_string_to_word_list_rl_enable_paren_matchingcopy_function_def_contentspop_dollar_vars_rl_dispatchsourcelevelget_current_prompt_levelfind_string_in_alistdescribe_commandtrap_docmake_word_flags_rl_rubout_charphash_searchrl_vi_subst_rl_complete_mark_symlink_dirsbash_input_fd_changed_rl_set_the_linetest_docalloc_word_descrl_insert_moderl_directory_completion_hooksv_opterrstupidly_hack_special_variables_rl_search_getcharsetifsstream_listset_itemlist_dirtyfatal_errorsubshell_argcpre_process_lineprint_arith_commandrl_completion_matchesrl_tab_insertstring_rest_of_argsprint_var_functionloop_levelextract_arithmetic_substlocaletransarray_to_stringrl_modifyinghistory_tokenize_rl_redisplay_after_sigwinchfind_flag_rl_make_prompt_for_searchfg_builtindispose_exec_redirectsreturn_doc_rl_get_char_lenlocal_exported_variablesunset_bash_input_rl_abort_internalrl_copy_region_to_kill_rl_move_vert_rl_meta_flagmake_case_commandrl_undo_listprintf_docconditional_doc_rl_reset_argumentrl_make_bare_keymapinitialize_shell_optionsfail_glob_expansionget_working_directoryrl_get_next_historyfind_tempenv_variablemake_function_def_rl_term_dccommand_builtinsh_unset_nodelay_modestatic_shell_builtinsset_var_read_onlyrl_completion_mark_symlink_dirscolon_doccd_docrl_invoking_keyseqsfunction_dochistory_get_timettcbreaktime_doczwrite_getenvstdin_redirget_exitstatrl_read_init_filevi_insertion_keymapbuiltin_builtinrl_filename_completion_desiredbuiltin_addresshistory_expansion_rl_term_gotorestore_original_signalsmaybe_save_shell_historyunset_sigwinch_handler_rl_in_streamrl_completion_display_matches_hookreset_shell_flagsrl_end_undo_groupbegin_unwind_framedisown_builtinrl_crlfset_debug_trap_rl_copy_undo_listrun_return_trapdeclare_doc_rl_restore_tty_signalscheck_binary_filedispose_saved_dollar_varssh_invalidoptname_rl_screencharsrl_named_functionlist_all_jobsrl_bind_key_if_unboundrl_unix_word_ruboutalias_expandmake_local_variabledisallow_filename_globbingalready_making_childrenreset_internal_getoptrl_vi_prev_wordexpand_string_unsplitifs_var_rl_keymapde_backslashbash_directory_completion_matchesrl_executing_keymaprl_complete_with_tilde_expansionsame_file__data_startcurrent_command_first_line_savedbash_history_disablewhich_set_flagsrl_display_match_listrl_delete_horizontal_spacerl_unbind_key_in_map_rl_move_cursor_relativeget_group_listbash_initialize_historysh_mktmpfpglob_ignore_caseall_shell_variableslist_one_jobrl_replace_from_historysh_invalididrl_vi_putrl_backward_kill_linerl_free_undo_listzreadintrhistory_delimiting_charswithout_job_controlrl_arrow_keysmake_command_stringtype_docmap_overset_default_langdispose_used_env_varslcurrentfifos_pending_rl_callback_data_disposemake_if_commandwait_forvariable_help_docthis_command_namesource_fileignore_tty_job_signalsclean_itemlistsubshell_envpsv_histsizehistory_doc_rl_free_history_entryclose_fd_bitmapbash_getcwd_errstrpush_dollar_varserr_readonlyrl_free_line_stateset_working_directorysubshell_environmentrl_outstreamprint_simple_commandsv_comp_wordbreaksphash_insertrl_save_promptrl_dump_macrosmake_variable_valueread_from_stdininitialize_signalsuntil_docit_functionstilde_expand_wordlegal_alias_namefunmap_program_specific_entry_startexpand_words_shellexpsh_neednumargtilde_additional_prefixescommand_substituteadd_aliasget_word_from_stringget_hostname_listyycharasynchronous_notificationrl_completion_found_quoteifs_cmapcase_docassign_array_from_stringrl_pre_input_hookshopt_builtindirs_docgetifs_rl_char_search_internalstrlist_resizerl_vi_back_to_indentrl_vi_checkexecutable_filejsmalloc_trace_at_exitinitialize_flagsstrvec_from_word_liststdin_redirectsbind_keyseq_to_unix_commandsh_backslash_quoteposixly_correctset_login_shellterminate_stopped_jobsbash_badsub_errmsgarray_unshift_elementrl_vi_delete_rl_vi_textmod_commandrl_vi_bWordrl_reset_line_staterl_variable_dumperit_builtinshist_verifyget_name_for_errorprivileged_modeno_line_editinghistory_comment_charrl_already_promptedsplit_at_delims_rl_arg_callbacksh_restrictedinterrupt_statethe_current_maintainerrl_tty_set_default_bindingssh_setlinebufrl_unix_line_discardrl_vi_fWordrl_make_keymap_rl_fix_point_rl_with_macro_inputsh_backslash_quote_for_double_quotesvalid_array_referencesh_makepath_rl_find_prev_mbcharexpand_words_no_varsrl_completion_entry_functionrl_vi_insert_begfmtulonglong_argspipefail_optmailstathistory_search_delimiter_charshistory_search_posmap_over_funcsrl_vi_char_searchsh_nojobsttrestoreprint_cond_commandrltty_set_default_bindingsassign_array_var_from_word_listrl_begin_undo_grouprl_initialize_funmaprl_library_version_rl_unget_char_rl_pop_executing_macrointernal_wstrmatchget_job_by_name_rl_comment_beginkill_all_local_variablesit_setoptsexecute_variable_commandrl_get_keymap_name_from_edit_moderl_insert_textrl_attempted_completion_functionhash_builtinarray_keys_rl_want_redisplayset_default_localeit_filesmark_modified_varsread_builtinrun_debug_trapget_random_numberwordexp_only_rl_complete_show_allreset_parsersigint_sighandlernum_shell_builtinsgen_compspec_completionsset_return_traprl_get_termcapmk_msgstr_rl_init_eightbit_rl_term_backspacehistory_expand_rl_callback_dataexecuting_line_numberexpand_string_to_stringunstifle_history_rl_find_next_mbcharrl_event_hookexit_shellinit_yy_ioclear_hostname_listlist_optarg_rl_output_meta_charshash_copyarray_create_elementglob_vectorexpand_word_unsplitshell_is_restrictedrl_vi_overstrike_deleterl_digit_argumentrl_vi_overstrikerl_capitalize_wordrl_bind_keyseqsave_pipelinestrlist_createrl_vi_set_markreadline_echoing_pinternal_warningrl_redisplay_functionfc_execute_fileyy_input_name_rl_scxt_disposechar_is_quotedfind_index_in_alistsignal_is_specialwith_input_from_stringrl_noninc_forward_searchrl_yank_nth_arg_rl_dispatching_keymaprl_stop_outputforce_append_history_rl_dispatch_callbackprotected_mode_rl_to_lowerbash_logoutclear_unwind_protect_listrl_vi_delete_tosecondary_promptsh_optargrl_history_search_backwardis_directorymove_to_high_fdrl_num_chars_to_readrl_transpose_wordssh_un_double_quoterl_char_is_quoted_pmake_arith_for_commandbash_history_enablerl_terminal_namefind_user_commandlist_lengthglobal_error_listsh_erangezcatfdcaller_dochistory_set_history_stateunbind_variable_rl_pushed_input_availablerl_callback_read_charsignal_is_trappedenable_builtindelete_last_historyrl_revert_linerelease_statusrl_start_kbd_macro_rl_overwrite_rubout_rl_strindextrap_builtinhelp_builtindispose_var_contextshopt_listoptsh_needargansicstrdispose_function_defarray_to_argv_rl_callback_funcsv_localesubshell_top_levelshell_namexstrmatch_rl_vis_botlinstrlist_appendfc_docrl_get_keymaprestricted_shelldont_save_function_defs_rl_set_cursorstrcreplaceclose_pgrp_pipehistory_no_expand_charsrl_set_signalscompletions_to_stringlist_rl_output_character_functionrl_delete_textshow_shell_versionevalexp__libc_csu_initungetc_with_restart_rl_argcxtttnoechodeclare_builtin_rl_term_uprl_attempted_completion_overrl_deletepush_contextrl_replace_linesh_badjobrl_upcase_wordrl_completion_word_break_hookstrip_trailing_ifs_whitespacerl_markarray_variable_name_rl_term_icrl_backward_byte_rl_last_command_was_killdispose_word_descclean_simple_commandrl_re_read_init_filerl_vi_goto_markcd_builtin_rl_isearch_callbackmake_redirectionrl_forced_update_displaycheck_window_sizeprogramming_errorrl_noninc_reverse_search_againxmbsrtowcsarray_expand_index_rl_arg_getchar_rl_completion_case_foldrl_vi_change_casecommand_errorloptendarith_docshell_version_stringexpanding_redirreturn_EOFsync_buffered_streamrl_linefunclogout_builtin_rl_term_autowrap_rl_allow_pathname_alphabetic_charstrap_saved_exit_value_rl_isearch_terminatorsset_ppidstartup_statestrlist_mergeexpand_compound_array_assignmentrl_vi_fetch_historyit_disabledhistory_get_history_stateprogcomp_flushecho_command_at_execute_rl_pure_alphabeticforce_fignorewait_docrl_exchange_point_and_markshell_start_timebind_functionparser_errorbash_groupname_completion_functioncurrent_prompt_stringgetopts_resetrl_vi_domoveremember_mail_datesexpand_wordsparse_symbolic_modedecode_prompt_stringrl_set_markwait_for_background_pidsstrvec_resizeif_docextended_globassign_array_var_from_stringdisplay_signal_listfree_pushed_string_inputvi_movement_keymapdo_redirectionsstart_jobget_new_window_sizecontinuingaddtimevalmatch_ignore_caserunning_trapansic_shouldquoteextract_process_substrl_dingfalse_docset_pwd_rl_callback_data_allocrl_vi_columnneed_here_docabsolute_programhistory_reeditingrl_refresh_line_rl_is_mbchar_matchedrl_last_funcstrvec_removebreakingxtrace_print_assignmentbind_array_variableexpand_string_assignmentjump_to_top_levelrl_complete_internalstrlist_copyignore_signalfind_aliasdelete_all_aliasessh_syntabsizttgetattrunlink_fifo_liststrvec_lengetopts_docpop_streammake_group_command_rl_digit_pskipsubscriptrl_set_prompthash_sizerl_vi_first_printredirection_expandlegal_identifierfile_errorlist_optoptgrouping_braces_docplace_keywords_in_env_rl_erase_at_end_of_linearray_keys_to_word_listbind_int_variableoptflagsreset_mail_filesskip_to_delimcaller_builtincommand_oriented_historysh_validfdrl_discard_keymapsv_history_controlsigwinch_receivedsh_physpathwait_intr_bufmaybe_make_restrictedrl_unbind_key_rl_digit_valuerl_vi_ewordadd_unwind_protecthash_disposerl_invoking_keyseqs_in_maprl_line_buffer_lencolon_builtin_rl_history_preserve_pointunbind_funcsh_realpathrl_vi_replacerl_reset_after_signalget_tty_statemake_until_commandcopy_function_def_rl_iscxtrl_filename_completion_functiondo_assignmentrl_alphabeticrl_vi_insertion_moderl_catch_signalsrl_kill_textrl_visible_statscopy_history_entry_rl_scxt_allocrl_forward_wordremove_backslasheshistory_arg_extractget_locale_varrun_unwind_protectsrl_basic_quote_characterssetup_async_signalscurrent_readline_linesearch_for_commandrl_add_undo_rl_fix_last_undo_of_typeunfreeze_jobs_listsignal_in_progresstest_commandrl_special_prefixesrl_vi_bwordphash_flushdispose_redirectsrl_vi_eof_maybettonecharcheck_bash_inputsh_get_home_diremacs_ctlx_keymap_rl_vi_last_commandsetup_ignore_patternsrl_forward_bytesh_badpidfull_pathnametteightbitforced_interactiverl_completion_suppress_quotetimes_docrl_backwardarray_assign_listset_minus_o_optionall_digitsdebugging_login_shellrl_get_previous_historyrl_getcrl_variable_bindget_numeric_argeof_encounteredshift_docifs_valuemake_commandrl_deprep_terminalreset_mail_timerrl_completion_suppress_appendhup_on_exityyerrormake_bare_simple_commandfg_docrl_promptrl_filename_quoting_functionfilter_stringlistrl_kill_full_linesh_getopt_restore_statedelete_all_jobssigwinch_sighandler_rl_compare_charssv_optindrl_vi_fwordrl_point_rl_any_typeinecho_builtinread_commandsh_invalidnummake_here_documentset_langrl_readline_versionrl_function_of_keyseqcurrent_fds_to_closearray_quotequote_string_for_globbinggnu_error_formatclose_buffered_streamlocal_docinteractive_shellulimit_builtintypeset_docexpand_assignment_string_to_string_rl_mark_modified_linesset_dirstack_elementwait_for_single_pidrl_endbash_dequote_textset_or_show_attributesrl_beginning_of_historystrlist_flush_rl_saved_line_for_historydecode_signal_rl_free_match_listrl_parse_and_bindphash_removerl_menu_completeunalias_builtinbrace_expandfind_path_filebase_pathnameansic_quotemake_local_array_variableprint_timevalhistory_search_prefixnohup_all_jobsrl_expand_promptthrow_to_top_levelcompspec_copyconnect_async_listttsave_rl_last_c_poscopy_redirectall_visible_functionslist_stringcopy_commandpushd_dockill_pidnew_fd_bitmapterminating_signalrl_vi_movement_modeadjust_shell_levelsh_badoptdequote_listsh_mkdoublequotedfind_special_builtindispose_function_def_contentsrl_prep_terminalparse_and_execute_cleanupparse_command_rl_set_screen_sizerun_pending_trapsfile_iswdir_rl_current_display_linebg_builtinsh_get_env_value_rl_vi_set_lasttrap_listrl_insert_closestrlist_printrl_clear_messagefc_builtinxtrace_print_select_command_headtimeval_to_secsfalse_builtinrl_vi_next_word_rl_bell_preferencearray_shift_elementcontinue_builtinarray_shiftfind_or_make_array_variablerl_discard_argumentrun_interrupt_trapget_group_arrayprint_shift_errorgetopts_builtinbuffered_ungetchartempenv_assign_errorshow_var_attributesxtrace_print_cond_termprint_var_valuesh_wrerrorsh_syntaxtabcurrent_builtinfmtumaxit_commandsrl_blink_matching_parenrl_set_paren_blink_timeoutrl_vi_undorestore_parser_staterl_quoted_insertwhere_historyrl_startup_hook_rl_arg_init_rl_vi_done_insertingcdable_varsglobal_commandextract_colon_unitwcsmatch_rl_nscxtmaybe_call_trap_handleropen_buffered_streampatch_levelSBsv_pathit_aliases_rl_to_uppercheck_dev_ttystrip_trailingbrace_expansion_rl_update_finalit_directoriesread_docprogcomp_createglob_error_return_rl_term_crdispose_wordsrl_prefer_env_winsizedefault_buffered_inputcond_expand_wordit_hostnamesrl_cleanup_after_signalfind_token_in_alistrl_char_searchprogcomp_searchrl_set_keymap_from_edit_modesv_tzcommand_docrl_maybe_replace_linereset_shell_optionsit_exportsdollar_dollar_pidrl_inserthash_doclast_made_pidunclosed_pairset_dollar_vars_changedmakunboundterminate_immediatelyrun_unwind_framesubshell_level_rl_next_macro_keyhangup_all_jobsthis_shell_builtinconvert_var_to_arraymake_new_array_variableit_usersbuffered_getcharprogcomp_disposereadonly_docrl_noninc_forward_search_againxtrace_print_case_command_head_rl_lowercase_ptest_bracket_docpromptvarsinitialize_itemlistjobs_docnetopenminus_o_option_valuedump_po_stringsnotify_and_cleanuprl_kill_linerl_vi_matchcurrent_historyset_default_locale_vars_rl_possible_meta_prefixeshistory_listcompspec_createcomplete_builtin_rl_arg_dispatchrun_exit_trapshell_ttystrvec_to_word_listrl_insert_completionsstrlist_walkrl_backward_kill_wordextract_command_substperform_hostname_completionrl_vi_end_wordbashline_reinitializepop_argsexec_redirection_undo_listnohup_jobsignal_is_ignoredarray_quote_escapessh_optindassign_compound_array_listwith_input_from_streamrestore_token_staterl_push_macro_inputrl_readline_namerl_bind_keyseq_if_unbounddispose_commandmbstrlenxmallocsave_bash_inputtest_binop_rl_read_mbchararray_variable_partrl_undo_command_rl_screenwidthall_shell_functionsexpand_aliasesecho_docexport_docps1_promptprogcomp_insertfd_is_bash_inputhistory_word_delimitersreset_shopt_optionshistory_max_entries_rl_start_using_historysh_opterrrestart_job_controlsort_variablesmail_warningcompspec_disposetest_builtinpush_var_contextstrlist_removerl_callback_handler_installspnamearray_flushrl_emacs_editing_moderl_maybe_unsave_lineword_token_alistfree_mail_fileshistory_total_bytespush_argsxtrace_print_word_listterminate_current_pipelineunary_testlist_reversearray_to_word_listmake_while_commandprimary_promptallow_null_glob_expansioncheck_add_historyyylvalrl_explicit_argrestore_pipelinerl_read_keystop_making_childrentilde_expansion_failure_hookdump_translatable_stringslet_docmake_arith_commandbreak_builtinhistory_numberphash_createdo_assignment_no_expandrl_maybe_save_lineadd_or_supercede_exported_varunalias_docsetup_glob_ignoremake_absoluterl_list_funmap_namesvar_lookupshell_initializedrl_completer_quote_charactersEOF_Reachedtop_level_cleanupglobal_variablesword_list_remove_quoted_nullsprint_rlimtypearray_copyrl_vi_yank_argrl_end_of_historyrl_callback_handler_removerl_extend_line_bufferrl_set_retained_kills_rl_match_hidden_filesset_pipestatus_from_exitinternal_errorrl_vi_append_eolstring_list_dollar_at_rl_kill_kbd_macrocopy_wordrun_trap_cleanupdebugging_moderl_vi_eWordremove_unwind_protectzreadbash_re_edit_rl_undo_group_levelyynerrsprint_var_listeval_builtinarray_from_word_listexit_docexit_immediately_on_errorarray_sliceget_alias_valuett_setnoechorl_completion_quote_characterjobs_builtinreturn_catch_valuebg_docset_signalerr_unboundvarreport_errorread_but_dont_executesv_ifsdelete_all_contextsecho_input_at_readstring_to_rlimtypedot_found_in_searchyyparsemake_for_commandrl_unix_filename_ruboutrl_downcase_wordit_bindingsno_empty_command_completionrl_stuff_charset_var_attributebgpidsset_sigint_handlerprogrammable_completionsalloc_history_entryshell_glob_filenamerl_do_undothis_shell_functionarray_needs_makingsh_eaccesscomplete_docnoglob_dot_filenameswait_for_job_rl_term_DC_rl_bind_stty_chars_rl_qsort_string_comparestring_quote_removaldifftimevalfind_function_defhostname_list_initializedsource_uses_pathget_dollar_var_valuerl_vi_change_toarray_to_assignrun_error_trapit_enabledhash_bucketrl_erase_empty_linesv_globignoreexecutable_or_directoryzreset_rl_read_mbstring_rl_screenheightrl_do_lowercase_versionget_job_specrl_dump_functionsmake_funcname_visiblekill_builtinrl_vi_arg_digitxreallocexpand_word_leave_quotedsubst_assign_varlist_rl_overwrite_char_rl_term_clrpagrl_set_keyhistory_truncate_filerl_vi_bracktypereset_terminating_signalsjobs_m_flagexpand_stringrl_call_last_kbd_macrohistory_set_posprint_array_assignmentmake_bare_wordrl_function_dumpersv_terminaloriginal_pgrpisnetconndot_docinitialize_shell_variables_rl_clean_up_for_exitreap_dead_jobsalias_expand_word_rl_complete_show_unmodifiedxtrace_print_arith_cmd_rl_uppercase_p_rl_keyseq_cxt_disposeget_string_valuearray_walkrl_history_search_forwardthe_printed_command_sizepush_scopeexecute_shell_functionwith_input_from_buffered_streamrl_prep_term_functionmake_pattern_listthe_printed_command_except_trapredirection_errorrl_delete_or_show_completionsrl_yank_last_argit_stoppedset_if_notrl_username_completion_functionlist_stopped_jobs_rl_replace_text_rl_walphabeticno_exit_on_failed_execgather_here_documentsbash_history_reinitsv_hostfiletimeval_to_cpumerge_temporary_envsub_append_stringrl_bind_keyseq_if_unbound_in_mapinteractive_commentsrpm_requiresstrlist_sortmake_default_mailpathrl_save_state_rl_add_macro_charfunction_trace_modeit_variablesload_historyassign_array_elementtilde_additional_suffixestermsig_handlerpwd_builtinit_runningextended_quote_rl_history_saved_pointsetup_history_ignorecopy_word_listpushed_string_listmake_cond_commandtest_unopinit_job_statslocaleexpandstrvec_flushrl_vi_search_againbash_tilde_expandreadline_internal_teardownbind_docshopt_docrl_line_bufferrl_restart_outputrl_numeric_argcount_all_jobsrl_end_kbd_macrolegal_numberread_history_rangearray_subrangerl_vi_editing_modeinitialize_readlineinitialize_job_signalsrl_vi_ruboutmake_childunbind_function_defrl_end_of_linerl_bind_keyliteral_historyread_secondary_linesv_mailhistory_offsetstrvec_createshell_function_defscopy_redirectsxbcopydelete_all_variablesrl_untranslate_keyseqexpand_string_unsplit_to_stringstop_pipelinefd_to_buffered_stream_rl_print_completions_horizontallyrl_vi_completeprogcomp_walkterminal_pgrpassign_in_envfile_isdirshell_pgrpstrvec_strcmpGLIBC_2.1GLIBC_2.0GLIBC_2.4GLIBC_2.3GLIBC_2.2GLIBC_2.3.4/lib/ld-linux.so.2  j0ii ;vii Evii Ovii Yvii cvti mvii ;vii EvPě6ț̛ЛMԛ؛PQQQ QQQQQ Q $Q (Q ,Q 0Q4Q8QQ?Q@QAQBRCRDRE RFRGRHRIRJ RK$RL(RM,RN0RO4RP8RQ94 fD$D$ $ \$$ۆț1O$=~8-fY5=@Nz--xzkvt,,u#@@u$ W<$芫558۸u 1=$,$ Di$|$< 9tЛ$$ț$$e=D$-$i}; 8s?Phu)x<xDž1;HTD$D$$ SO$ 0D$D$$ &O$ Z0$B Tt 8e1 $ T1D$W $<;t[1ɡ \Mț$؛$b$?(&p6tzL8-=Lu^ 18Л$X$t =Ȱe1l1BD$޿$$El1EƿE'US$ EE fND$$PtGE bbD$ \$D$$h s&tkut EEtcE\T$ EtE$谾E- $[]Ívu$D$$Et $$v t E먋EGE$蜽E0$yU]Ít&'U]ÍUt]f] É'U ]t&UMtt  ]Ð&Uu]t]É'UE]Í&UUut 9Pu]]1É'UUtPBTBX]Í'Ut u] à ]ÍvPU{t#~(= t~-v1]-w]Ã&tt&~(t;t1΅tփ vt1뾍v'U==|U]=v~"=|=f~=$t؍&1]=}=t|- t&v1܃)~;ft|̃{v1f(} t&{sf랍&'SL USuD T)tDtV=X t19t u [][7 ]Ã=X(7 t=\y[]ËX7 tȁ u  < t2< t.!tGU$$T$1Ǎ^똋8$:Ë8߉$ܺ$f!#^$T$-$' 5vlD$D$$褸ƄlSWt$nzD$$D$޽Uu=$$^ $Sv0\^D$  D$D$D$,\<$D$KPTbPT$$\$^$芼`$赽$]SdStSTS@SAl$@ƅl! t€u҃)A$^|$$ɻM$p$$SaDSeSr<G$^I= =G GЛ_' $P$ht $(pÉ$2I$T$Ǎ^U~{^)`$$蔵4$ڹ$<}t<}u<;u %CXC|$ l\$D$<$[$@@ƅlUu $<$^c k]D$t$$E$$@@5@(@@@0<0<0<$- Uɉ$ DT$u#^@|\T$$\$$¸ShD$.$ótgaDTnG\T@GG@,\^<$D$($S[Dž@1ɺ8$ 60t:ll/rD$/$bD$D$$)FD$ D$ lD$<$蒻@1E=ً! t€u҃)ٍAwlD$$ҹمt}! t€u҉ȃ)Z\\@Q HD$ D$ $WD$ D$ ƅl.Dž@^׼m<$芮ۉ:$贰u- v== <+p&$趿9} D$$0=U 0{Л$c $-{ = t5?u =t_ț|$ D$D$$贪==t/ 9 D=y|k=At |utV8;uQ<$fK=Л$'1df =B B<$D$bǣi _'UWVSlE UMt/`t*'E}"U ҃U'EE"Et M M$@MEEEEEE̡E@E7}ԃ9}Uԉ M̈ ]}ԋEą"E (EuEt #]ą. vJEԃ9EMԉẺψ]EeUMtM9Ẽl[^_]ÃE@;}}U؉T$M̉ $~Uԃ E̋M̉  EE@;E}E؉D$Ủ$@ER~|@MԋEM+t&t&&;uNE9Et MK;uE u}ԃ;}}REԉÜ}'+\!M9MR^+$SEE@;}}U؉T$M̉ $E뎋~|8]ԃ9]~EԉߋULsE@;]}U؉T$M̉ $赸Eɀ}}E7/}ԅEZ|EB;uƒ}{ ~|E~|9]' ؈Ej~|OE܍M $D$V-EЁ}t}t-U>A|1t "Et#9ETUЉT$E$蜩}EЅMЉ $胦$~|EbŰMD < +< #< h|EE~|mE \f~|E}"}`t&E({Äu ~|j1;u)E[}tEj9EGE@;E}M؉L$Ẻ$HE$E|E`~|E܍U`$`D$1E@E@;EaE@;E}fQM̉ $4D$D$|$ $hUT$D$Mȉ $nJEtEl[^_]ËE܍U$D$B D$$'7E܅fED$ ED$D$MЉ $7ËEЉ$zE܅E]ЉE[sUu E܅m~|RED$MȉL$ ED$D$EЉ$eUЉ$D$E$D$EЉ$転EESEܹ)(D$E$1Eh$EЉ$qUЉ$覤EE܍U}${D$1yEẺ$*EtM܍E[$1L$]ۉut \%\9lj`y;Q&v(&`/)(5$u >t#pw[pEwt =8 pUE^t|t pĜpd({[$t&"t $v"pEP~|1 h8h`+h" E~|s([~|@9 )(E(D$$h-=t Ehp9}pĜӃ D(9}ĜhT$$˦Ĝ비U~|:{[ (9 )(E(D$$h-ddt Ehp9}upĜӈ Ld؉$T$rd]EEpd $?EE9}ĜhT$$wĜ`B D$$T ['xxu "~|9f  xD$E$y-=t9 xy E܉D$ E4$D$D$4$$5$ߓ4$E܋E܋hp9}Et$pĜ$視]t4$藓pEEO9}ĜhT$$ģĜEE]D$[$h^dPD$$4$'wPP=t!p=$U9d,p\EĜp3$M ~|E]D$[$h=tG Ehp9 pĜ[؉t$$]Ep4$ۑEEE~|$葢@$$@ph9}:\$pĜ$^p$OEE9}hD$Ĝ$艡Ĝ렋pMĜEut-<>P=!=# M~|=P}5 ltl;el\t\;{} 5p } ]tB;]u={]u7{u0t&U | $t!}~U|t M M tAUu:5\uP=t=$t-t  %\$u#~ |t M MR$ATp$*TAĜD$$ Et TOEt THlĜM| )#\$ D$mJTPpp$t] t$ftMtBĜD$$޸t @{Ĝ1@Et \@phD9pĜ8=D(z؉t$$ĜU)p4$EDžlE}D${$hdE܉\$ D$E4$D$D$zM4$tD$E܉$D$$SEvB D$$蝚R \<PĜ'B D$$BU^]me>ĜhD$$Ĝt X~~|c1t u91=tS%\ B D$$fwm= l :B :B :B \@PTW9}ĜhT$$јĜ>&{{p ։o %\tP=!t =#~|-8覼TOcRH&T== = - ;d{o{u t&P葼U=Ĝ17Up:uD$<$诎uء\q6|#<%+-])Lt"$t$qxD$D$<% $軁4$D$'=R6D$D$$ $b\$D$`$i'$w`&t#t|t#t|`>tt~Q|uEt `|t@&~|&'~ |t(D$D$%  !e#[DžpEDžlEEP= L-({\O ~|4 \&=P(tb\u2  ~|߉\ ~ |t\=Tu~|w\\X1ҍEtyE11Ҿ(\ \1ң Eb=DGUD$$JFGU@2D$$F[QFt&'U1 du twÉ'UWVS5=(==8!$藕15r=RD$ D$$D$@t$D$ $D$d@[^_]Ívxw$ltփѡD$ D$$D$ @1=<>ocvT)K躷D$D$% $(|\$D$$/"${<$1ldYD$D$`& ${\$D$$!$Z{<$.l4$jd1[^_]É$M1%\=fD$ D$$D$>|$t$$D$ w>[^_]$ JD$ |$$D$>>d=D$D$& $1z\$D$$ dv+=d)D$ D$D$$=GEf諵D$D$& $zt$D$$ 4$yc4$+iTD$D$% $y\$D$$$Uy t $t&jdtkD$D$l% $cy\$4$D$o$xD$D$% $*yD$$5D$D$ $x4$D$S$$t 5U5:=c  :T :BD :B4 \D$D$,' D$D$8& $CxD$$N"D$D$& $xD$$Q&US$=dt؃[]\$D$$D$ ;É[]ÍvUS=dt؃[]\$D$$D$ :É[]ÍvU]몍v'U$M:Ít&'UStfC D$CD$ CD$CD$C$7=t5CCt$kv$cv[][]áx¡0t7U0x#CD$D$$t|CD$$sCCjmt&US$ 轆D$$Í@D$0=Ct@CEt []áxD$$grCfUWVS,H\}]u EdEEءEEܡ E䡄E$|$P $t \ 11=)t6 t't$$<Ǎv8uP gEH\EdE E裄EࣴEܣt %\xtjt\tVu,[^_]-E؋E؋L$L۳Lt4$cxI,[^_]áu $u $$UD$E$oÍt&Ut* u"$wt--à UVS$rt% t҃[^]Ë5Y$16]$$\ut-\$$54$t4$Í@D$4 DD$$蘂/D$$~'\$ t$D$C؉$!&TW|TWoTW@p@؅tt$\$ t$D$A$%TWTWTW@p@؅tt$p\$ t$D$A$S%TWTW1Džs DžVCP‹u D$Q$T$&CD$S$T$%$?JQ u v‹uO <)BD$B$ "AD$A$! q^KTWq@$1 +D$$#\$ t$D$C$"TWTWTW@p$1 >+D$$~#\$ t$D$B$A"TW|TWoTWq@$1 *D$$#\$ t$D$C؉$!TWTWTW@p$1 b*D$$"\$ t$D$B؉$e!TWTWTW@p@؅tt$\$ t$D$A$ TW9TW,TW@D$ CD$D$Cȉ$ TWTWTW@D$ BD$D$Bȉ$^ TWTWq.gB8YD$&D$$ * ID$ $HD$#D$ HD$B$"D$$HD$"kD$HD$C$y"<D$$HD$I"D$HD$A$"HD$D$ $!HD$D$ C$!JHD$D$ $V!HD$D$ B$ !D$ $HD$ D$ HD$C$ D$ $HD$ TD$ $HD$a $D$ HD$C$2 DžD$$HD$D$HD$A$MD$$HD$ZD$HD$B$+D$$HD$D$HD$C$D$$HD$_D$HD$A$m0P:ED$&$D$D$HD$C$D$D$C${ =Hv6<6$6 01$1D$&$D$LD$&D$$)D$&D$$D$&$D$A tA vt@/t;Qҍvt4‹^u"u$tt /vu]1]ÍvUSM ]~%< t1҄uv< t t 9u[1][]UUttt=u9t2E؋U܉W M uŃM u1]u}]Í'UWVS<]eE1u }E$t$D$ D$ 0$t$D$ D$ 菈É ؉uMSL t0D$ |$D$- $?Ee3u<[^_]ø:!F'USE ]t;/t\$D$$Vv[]É$\C$ R] E[]D'UVS];~tS$C$Q\$$Cƀ>/t$t$D$$u4$@ރ[^]D$$뺉'USU<+tG<-tQ0< w4$LÅt&$B$3Q\$$+C[]Ð1[]ÀzBt므zBu$' U$' E뗐U$ ]}}u"t\$A~MD$|$$Fu97u?D$D$$=~t&]u}]Ð/u뺉'Uuu]]tIteVK31 t]1u]Í&KXFX[\V\u11ڋ] ]Íut$E$D$MPUPU P UPUPÐt&US$L$ L C CPUCP؃[]Ít&'U$]uuLtt 4$ƋE sC C؋u]]Í'US] $:LUX@@ []Ð&U$KUPD$$ U$ ]ӉuΉ}KXp<$D$W]u}]Ív'UUM ] UUM ]|U]]uu }}$,KXpx ]E uE}]fUE]]uu }E$JXEGtt 4$Ɖw ]} uE}]FU$~JUPD$$ ÍUEE]] u։}ωE$5JUpXx P]E Eu}E]UEM UE EE]냍vUEM UE EE1]cvU]]uu}} $IX px]E uE}](&U(]]uu}} CPtCtuu} }]]]nx ;uBuZ:uUBx ;tt&F:uBx ;fu ыPBtMt$|$$ MQB؋u]}]É]ӍvU̯~!Pį̯EBE Ð$H‹EBE ÍvUEuu}} ]}tZt+EXC4$D$vCE]u}]ÍvEtt&uEPB EB E뜍t&'U~!P@Ð$G@Ðt&U$~G$<YGȯ<̯įÍ&'U(UE]] uu}UE$GUljX EwGGS$V 覌t2@t,@t%x|~OD$D$$kG|$U$G]} uE}]x v멐t&U8$]]uu }?FNjEw _GGwo$( ED$$'EE؋EU܋U3U3E $e$1 G EG]u}]ÐD$D$( $4t$$0G뺋$6D8-u$81 G GAtGBhGA[t&'UWVS,E@ Et8t3D$D$L( $,4U؉T$$I,[^_]D$MA$E$5UE܋B$3EMAAEEE@Et&E$赒  };tE܅E:$55}lj9}*EEEUT$M $.CEEEt$\$$4}Mț4$D$.}f>#U܅E:to Cf; t)U܉D$$T$9/M܀< "UtbM MA,[^_]ÍFE"U܉D$4$T$8vE܀< i$BUB$B UWVS1ۃt-4$2$RAt$$J3؋u]]$,A؋u]]Ít&'US]$~\$$b[]ÍUu1f8t$H2D$$Ív'UWV1S,EU EEEEUUEE܋B< tY< tUtV<;tPt<;u19rot@tJtQvt<$/;thS< u&뛃1uE뾍vE믉E룉)ЉD$D$$ rut$?E܉CE}USuEC UESUC$] E ,[^_]vD$D$x( $c.D$E܉$pUBD$D$' $0.\$D$E܉$91,[^_]D$D$' $-D$U܉$눸B EB EB zEfUEEEE$%ÐUWVS t/D$C$- D$֋tuܸ:Ճ [^_]Ð&UЭEU ] U]념t&U]Í&Ut.;}Ã考D$$<Ã?$?=Í&'UWVS<]eE1E E܉$?.cE]S&Eu&\$t$$-=MЅtsUtiE<%uMtEdl%ct&D$D$\* $+\$$MЅuMe3 <[^_]ÀsuU܍BE܋24$ -É@U܍BE܋xcUD$ T$$L$MÉ4$,DžG]E܍PUED$uD$ 0) D$ D$$0.&U~D<&t< t $ USÃ&unCtzt&C$7 vC $7 D$a$7 U[t$3) ACu$/* -CU$6) []ÍvC8$9) [4t&C$>) [t&C $7 D$$7 [uC $7 D$o&US]$C) jE"T []RfUS]$) :7 ET []'UE@$G) D$US]C$S) D$C [7 ] US]C$a) D$C [7 ] USÃh9~61҅~ dزD uڡd$.[]Ã9}hD$d$7d릍t&USÃ$SL qt;u []vÉ\$$7 []É'U]Éu}px Pwc@ $* 1FC) u:D$T$$r) PCD$C$- D$4t&]u}]ÃtT$$2 $) D$ʅw$|) D$$7 f랃tT$$2 $l) D$r4$t&|D$D$C$|$z) ÉD$T$p%t$T$$) 3tT$$2 $) D$tT$$2 $) D$T$$) D$T$$) D$pt$T$$) Wt$T$$) s>T$$) D$X#T$$) D$=t$T$$) $T$$) $) D$C$NzƸ) u:t$D$$r) 4$#]T$$2 sC$z) D$KT$$2 ktT$$2 Vs&'UWVSà C 11t6t1u {ؐKt0$7 C uʉ$tRDžuЅt<$7 v$SL u4$ [^_]ÉƉyC C _v'U7 S]CC t$7 &C [][]ÍvU(uƉ]}tz~Fuv vGD$ D$D$$* OF t8$7 F ]u}]H$* $:ut&]u}]Ív$3) Ty$) CF]$) -L3^$^$ &* \WC\W)p $/* F@$6) ^$) 7 C$ oC 7 $ VC7 $T =&* 3\WC6F$aF@$fL^$* ]C$SL +\W+$S -Fj V^C$) D$YD$$`U%$ * /\WC $28 M%\W)-S $)%F$yF@FX |&;D$D$* $\$$bF@G^$W4Fd ^$[ tj\Wv:C) Y$Y<\WC\W) u\W) ^$) Cw$) v\WCS{ \W)t-L) B\WC \W)V a $7 _ÉD$$) &uFHu$7 FZ$>) Fx($SL o\Wx @ @@:"\W)-@ * !{ 1$9) FPqt1 t$SL Fb$7 $ ˍv'UWVS E\W=Ut 8$!* XE* \W$%E $:8 tSU-=\WS Eu { S4$ [^_]fX @ @@E-ۉ=\Wt * A^ $SL p\W * 't&D$$@CD$$PS&USÃT$$C$%* \WC\W)p []t&UE~Í&UH$** ]eE1u}Ӕt8u(Ue3]u}]ÍD$+$x|$[D$-$x^t;tt&$D$|t$$g@ED$ t$\$$E߄ 1EtEU9 ~ b~׍t&;t33t+b&;tPtb~Ƈ$ t&EELU߉t$T$$E\1svt&'UVS uț\$$țD$D$$.* D$ }tG1D$CD$- D$D$ ț$t 7 uŸ:뾡țD$D$$2* D$  [^]fUWVSEUu țEEU}E\$$țD$D$$C) D$ }}vt.țEE E:* E[^_]Yt&țtz?tuD$<$zUD$D$D$ ț$]țtU:tD$E$1jE7* D$E$O7* 넍țD$D$$3) D$ } UD$D$D$ ț$țt?u7* D$<$USț~\$$fE@D$?* D$D$ ț$[]ÍvUVS ] u@tJFt;uR7 D$ țD$K* D$$&6uțE E [^]Ff$xgtT$j҉ø7 D$ț\$ D$- D$$$6늸:]$ju77 t{D$ț\$ D$- D$$h6=$D$D$jɉø7 Y:Oț\$$:{t&U]țuu\$$FD$S) D$D$ ț$D$F $!]u]Í&U]țuu6\$$FD$a) D$D$ ț$HD$F $]u]Í&U(Euu }}]EE>tuX\$ED$%D$D$ ț$9tt $t&ț]u}E]ft$ED$P* D$D$ ț$\릍4$duT4$|hTD$D$4$h=t&ț\$$ t&4$g U(E ED$ ED$D$؛$fUE$%D$7 $D$ÐUM;}7AAAAAAAߡ ]ÉM] &US]t$\;};CCCCCCCߡ[]É][] vUVS]uD{ 3w.K /|utC$C$G$u[^]Ít&UVS]u=aCCCCCCCߡ̯į̯t(C3$̯;ȯ|$Bu؃[^]Í&US]t:Ct$Ct$C t$u][][]fU(}}]uG t$ v4D$ D$D$$,+ }]u}]p$<+ _C$C$|$H‹G@$dG$-맍&]u}]ËG$놋_C$XC $MC$BC$$ JG$:_C$ $ GE@$EX u(fC$C$3$b uڋU$S _C$C $C$V$" _C$kC $$ s_C$C$ C $$ BfUS]C$;C $Ct E[] []ÍUS]$][]e Ut t ]Ívu&t t t uыB]@Ívuϐt&U w੯t]]1҉É'UWVS,]EeE1ɉU؉MEEغ gfff )))A0шD5uD5Et%1ҍ}vM܈ DuBщEغ)k<)ӋUm gfff))ÍC0ӈD5uD5t"U1U܍}DuME؋utJU.uE؃~61ۋU }܉<0. EЉUЋE0T8;]؉M uދEԅt UsM܉1Ue3u,[^_]USӃx$x$[]É'UVSut7~11&9~F<t$ F9[^]ÍvUD$]ӉuD$t+ $ \$t$$t]u]Ív'US]Ct$; ][]. v'UWVSUE} e M1ɉT$|$$G RD$$|$u%=@$g ]D$$xA(D$PL$$~ (#=<$ $Et&}e3=GČ[^_]Í&D$ $(D$PD$$ $p 1t(t$$]D$D$ $}L$$藰~;$Wf $:D$D$s $ |$$-3hD t&˰@$  <$Q<$Í@CD$2UۉىtTBuV8-E$ t<=~&$9$|$5=D$$? $! D$T$$D,  $~@e?, ,<<@w(x,|0E4E8E}ȉ<$SEzD$F$@FHC<$襸EtM $NJt }$$}\$$uUT$$hEt(Et}tM $賹FE t E $#EUxEEtD$U$EED$D$- $|$$ $D$M $t&$MA$I9EEEu, $U$ЉE$UEEEЅ1YUȉ$>QEȃl[^_]Ë}}EGt}tG $uv}t&}vEv E؅!$ E D$D$U $MUEWEU}G }}}$, \]YV 5EɉEt }tV ^4$l4$b$n$\$$U T$$4" Ef1]u}]Ð  $\F@IEMU <$D$ousE EU^|$ D$T$D$4$ MU D$$hE tY1}U ot&FP @$}tF t$F D$$GlEt"$zEl$9lpEt"$gzEp$pU UUt $3- MtE$PD$UtU$T$^ >$- tFF; EEtUD$$~E$CEt U$1Et $3- }t 1}E w E$HUtF~GU<$u1 $AuE u;Ht$p$$S\$$KH-0(EEtFF1EtF~GH$5t $qtGt tH$EY$BEEEFEt VUFtU FEUBU E$UD$EHEE裘uXt }t uEuEtU ]?$=EA$tFFEE M=VBtHE|$ D$D$ED$B$EtF~) EЋGۣt t +G$2$Au;Ht$$$h\$$`HBUEtFE~Eu Gt t +<$,$Au;Ht$$$\$$HlUEE裘FP @kEtF^UtCH{) =tt +CUEEuEECC U=E؋EU܋UE EC$Et u,CU=EU3EE-[UM<$T$U EuE u;Ht$$5$\$$H t 1ۅT}GEG $菋E${U҉E $] ]$p\$OutFHUB$- <E*$- c<t 8$- @<t 8PEEtv]1#xt x9}֋tFCt8u1Et E$ðU1ۉ؉|[^_]É4$ũ} E~?}cE~2}E~"}'E~1}؟E܅țD$]$'ț$zkT$pXK$P :8E:D$$|/UEvgu؉9`|9VM ljEUuEU ÉEUt uA]]̉]vEEVU؉1ȉE}  }cE~7}E~'}'E~}EE1E]E]]ԋE}ȅt}܋]V19t uCD$"* T$|$ D$țD$- D$$茻C8xt xE9E؋u]ĸ])E;]EUE‰U:$趿}ąwp؛1$ D$9t $t1D$\$u4$2@@DUB$75uvt $ptt$P 178 s$E19E؋uț$ D$uЃ9u uU=E=9E~@ț$ D$ lj؉)$ț$ D$EE vL$-D$ D$ D$$=VD$ D$ D$$E- U؉U?:u}-5<$$] 69@tu =$u7}<$ت$] E-$t&'UWVSED$F$vu'$t [^_]ËFEF $赃E$Y ƿU$pT$蓿 U1ۅ}<t&SF4$艑<$A`uD u;Ht$&$X$ \$$HátD$GD$E$z.@@,F$át?$f;4$v$m]{3UE-$$Y '[^_]ËFHU@t(u$t$E$蚧$Y 込-9$UWVS<H^S |>&q;D$ T$D$$- \$*wɋCtHC$rZ^C =f=;-t CtHC$Ql$fD$$ $HD$\$$>V>Fx |E$膼M U9|B$SU ËD$CD$B$pSE$-  \$$\$$ x|$$̺E$D$蹺L$$0裺tF@tHE\$|$D$ D$F@$dx<$lE}$^$$- ֹFpU M|$T$L$ D$4$x<$D$T$$舸<[^_]ËhF@$;$EM |$D$ L$T$F@$Ij[DžU SЀC U M|$D$T$L$ $CF@U M|$$T$L$ T$@N7ENM |$D$D$ L$4$7XC`Y KHfVCtHC0H'S$|$- Z谧T$D$$!Dž{z$^$o&UVS$ $- \$$޶U 1ɋE$D$D$N$t$- H[^]ÐUE]Ð&UE]Ð&UE]Ð&UE]@ ÍUE]@%Í&UUB%  t]1ËB;uB]fU1҉MA%  uA1;]É'UE]@%Í&UUB]Ut]]u$T$ƋCt$ns؋u]]Ít&'U]˭&USEE )‰t[]ÍvM ][]vUSEE )‰t[]ÉM ][]fU]&UU t:uEEEtEÍvED$$ktۍt&'UU t:uEEEEÍvED$$aktۍt&'U]&UExCt̐麗v'U]&UWVS̰}tZWtH71=݀Wt/)u|$$虵u׃t} ݄W[^_][^_]D$ D$D$ $W聪̰s&'Uаt uÐt&$eаÐUаt uÐt&D$$а$а7&U]u9~!B D$а$趼а5а5а]u]Ð&UED$P($藉Ðt&US]t$̫Ct$C$.][]饫USE;tX$9uڋB$j[]Ív'USCt=Ct`@ CtD$`3$È$+[]Ðt&D$D$@. $8$\T[]D$D$. $$2TUStCt9St[u[]ËStu C[]É$_C$ԇfUT$D$$Ɖ1҅tPɉÉ'UEt]]1É'UE]롐UE]두U1U VuSt[tSjt[^]fUSE ]u? t&$D$t@H t9E[]tАt&ttH uˍt&[]Ív'U1u 1=D$E$SÐUE$$$W t $$FW'USE$d1ңtZt;u PW[]Wf$XtD$ D$ D$$HfUE$UE$t Y'UE$tÍ'U$/ nEt&U-)$/ Ít&'UVSuCtyCt@ t$,Ctt5D$`3$轄C$肄$E/ [^]8D$2$舄ɍD$D$. $E[^]&PUD$$9$$/ `WÍv'Ut]3]Ív'UVS $/ t @1$/ t @1D$D$$trED$C$bt\}|d~~D$D$4$$EUEU|#w‰$ [^]ÐEE$ [^]Ív@Hp$}vwt&UWVS]$/ t @E$/ t@ukE11t(CD$D$E$u؉4$|$D$ÉD$E$][^_]v@E딋@El U$M tH tUu HÍv`Í&U$ ]uÍ$sC؋u]]Í&UWVS,E؉UԉM@7E؋xEU؋U܋EuЅEE]ԋ@ۉEtU$Uԅ}tMtIEЋx~jU1UUЈE9tOU:uD$E$uًEEzE؃EU9PH,[^_]Ë1UЋB9|P9|(EUЉGBEE$먋EЉP$D$زUЋzÉ볅fU]uu1]u]Ë@t$UÉI3$]u]ÍvUWVS } tU1J1ۅtYR؅ut8ƋC$U[u4$虡 [^_]1ۃ [^_] UVSu$Y1t4$荣$>t$$6CC CCE C[^]Ít&UVSE uD$E$sÉpt1ɺ`$KCX ؉[^]Í&U$t$E u]u]E u$t$]^&'UE $D$ED$0Í&'USt/t^t[]$L~[]D$$]@ã$~C$}돍UVS$z4$贡$et$$]CCC CCC[^]Ít&U]Éu}xơtE$9$\$$|$D$$Jp]u}]봐US]$n$D$ D$D$趛[]ÍUVS5tVt9Ft6vuD$1D$. ${$G[^]ËFu 1[^]Ë@ttËF$3$՝t4$뤍vUS$at$؃[]Ít&'U]Őt&U1]븐&US$T$gt$؃[]ÐU@]Őt&U]뵐t&U]륐t&U]땐t&U1]눐&UWVSD$E$XEuİ[^_]ËUE|(ذ҉U}rE1İ8 ;utgU:uET$D$U$0uȋU$>M İɉUE0PİܰB;E~MU ޅuuUEذ[^_]tO0 E B$ܰD$U ҉ãİޣ̛ذEtU$辝$oUT$$dİEXE$苝$<UT$$1İEİE'Uuu}} ]tw1>uPD$ԫËE$D$ǝ;t$$踝$D$]u}İ]f~t~t4$輜떍G$eËE$D$XfUED$$/ D$/Í'UWVSEUM‹}։ӃNܰB;ذEİ=ذUu[MGذt&UtM$L$İuڋE$v[^_]Ë$褛$U\$$Mİ{BܰD$İ$Eİ̛;UWVS}t E8E01fu$E1tlEM:^tAMuߋ$趚$g\$$_U^MۉUuEU<$.E[^_]EE[^_]ExEx$'EET$ $D$謞3?t&'USD$D$E$mvøt$Ct$C$l$d1[]Ð&US]trCuKuWCt$,Ct$$Ct `W][]fC$뻍vC$뫍v[]Ív'U]g&UWVSE u(t&[D$C4$D$Nut؋P҉UE@BMQ MA;0UBt$MAA%= AAt$E@Us$$踦\$$谘D$t$$vMH$G$聕<$y1[^_]É4$蠗$Qt$$IËG$<<$4E$$=$1[^_]ËM`WQ 돋A$vUD$E$Ít&USD$D$E$}søt6$h]6~Ct@u)$!C$j$b1[]Í`W΍&USPE bKC؃[]ÍvUWVStE~tE~u`1?ttuY؉$Ot$É$EE܉|$؉$4$躡:q4$LXE됉<$<띍U(uu}U]} FfT$|$4$D$D$ 4$ÉD$V9t t $腎Ft$uFtNFt `W]u}]D$D$ |$4$룉T$|$4$ËFt$^zv'U(EuƉ}ω]UtZD$ËE$D$"Cu&Ct `W؋u]}]Í&Kԉ#t@Ct$WCE tKE $D$ED$$D$D$ ƉD$S9us4$eE$D$D$ D$SAC@tC.4$[7 E c$D$ED$ ƋCt$茌CCuCt$pst$ D$D$C$4$A&US]C%0=0t ][]cSHD$$¡;tC B][]pc䍴&US]CtK$u t:SHD$$z¡;tHC B][]ct&'Uuu]}=_taVD$$¡9Xt1N 9XtF B]u}u]oHf;=t$hÉG$hÉGn UUB%0=0t U]f]v'UWVS Eu} ɉEtTtG@t$<$3$|$$܌CCt$ʉCu (v[tC t&tSDtKHEEE [^_]vA?US]$t H[]É$D$D$: uԁHH[]Í'U]]}} u$tvD$D$$1tBƃBt)D$|$$dtH]u}]D$|$$Չ$!1ɉ뛍t&'US4]eE1ED$E D$D$ D$ $$D$Ue3u4[]Ív蟌t&'US$eE1usE]D$ \$T$$D$$- D$:E D$ \$$T$ʩD$$- D$Ee3u$[]t&'UWVSE$tP u`usEtCt9Cta[uD$1D$4/ $$(0[^_]Ë@;uV[^_]ËVEU녋CF@vtFuE1$z됋SE NjEuNFGKO GE8It [^_]ÀxFuxSuxu<$;.U$$UT$$赈G눋K:D$$Ek15$cCvUE]u$)t@t ؋u]]ÐkƋCt$K؉s]u]Í&U]]uu t>$t ]u]áuHE ]E]UE$_t Ef1ÍUS]$;LtD$$J[]Í&{AuD$$JߍU$/ nt8u kD$ D$ D$$kfUE$t+,:tBt-Btf,!-^#Í&UWVSE\$t\8tWE$0 u0 D$$$($0 ÉD$r$nr==@TuD$ t$D$<$觔$+1 DT;@TtD$ t$$D$h$*1 $/1 1t.D$C$.uCD$D$$/1 H@ E@ED$D$$71 @ T@D$D$$D1 @ p@@D$D$$R1 H@ >@GD$D$$g H@ `G@D$D$$Y1 nH@ G@D$D$$a1 @PFF@ F@Uq1 $7pEz1 $@p/ $`p/ $`pV $`pb $`$M HEe3l[^_]É+EE*EEE u =tjMuD$L$4$}H`W=CU$uq$&ML$$rC>(u}N0 yE$+qUD$ML$É$qE u$t$q}D$$|$FEU|?)M $H`W?)sE={/z$'  $\pǡ$MpD8$~\$Ɖ$pD$>$p;0 pU$ D$U$ D$$$0 Ofx5H\$1 $1 X$3;/u&$Wo$~\$$p]=TTTT$oġ$:9 5TTTT$n둋TT[TTD$$L1 D$9$M (HP@ @pD$\$$*1 HKD$\$$+1 H$ ;A$ =f$O$ 1 06$' D$$5*ơ8.D$4$U4$Ukt&Ttotb$LmD$$ D$}UD8z(rD8(6.D$D$/ $jut$$$UVSHut<$l$X{\$$PmËFt$?j^[^]$#{ҍUS] t;t$i$)l$z\$$lE[]U(}}]] u<$賿@t$iFFt$Zt`$h FV ЃɉVtƒ VЀFt `W$h]R]u}]ÍF뢉<$5=k$y|$$kt$D$$NIE4ƋEp4&U(uu]}} 4$蓾t$[u] ]}}] _ G <$ _ E4$j$=yt$$5k\$D$$HUP]u}]Ív'UWVSED$$#$j$x\$$jE0ǀ;=B@t$}gEENFFFt$NgF<$iUE1:usUD$x|$É$jU=U:ED^`W?I<$f[^_]Àztzy$hlD08+<$R@@@<$_f1[^_]ÐD$ D$U<$T$S\T$$!i$F0S&4$Rf CD$$訽E$>$D$$vE<$'UWVSÃ,$-$育;E1]Er&4$lg$vt$$hËU9wt(1t$;g$u\$$gGEExEwEUEuGuʋwtËUE;wUWE$fE1>uwU܍D$auËE$D$TgU܍=>ujED&EU,[^_]D$G$D$@HY~t~u4$!fht$$ft&UWVS `W 5İt4$舯5İt0ېB1ɅtHR˅u1tB1ɅtJ;ܰذD$$ơFFt$$tl$bt 11҉;5t4$b$t<`W [^_]Ë5뙉4$ܰD$蟱ƣİ̛4$t$Qbt11҉뒍Ut4wQÐUS]$l1SP[]UVS$rV ËFCFC1t$C F1҅t‹FS1҅t‰S؃[^]Ðt&U$u}}]RrƋGFGFG F GFGF wO /|tG$ F]u}]ét_$,c$q\$$cFG$F뵍&'U1҉VS]t*1$%0ƅu…tE[^]u[^]ÍUV1S]t7C$Dt$$x(ۉuttE[^][^] Uuu]}tO$pNjFGFGF G FGFGFGF t $G > v]u}]Ë$@2 FYG$hpËF@ C F@$OCF@$mD$E$oÍ'UVS$ mËFCF$CF $C F$C[^]ÐU1UD$$!‹T3 D$[É'US$YD$$DIE ED$ ED$D$ț$\ț$ D$ `H\uGD$D$2 $X[D$D$ț$Xț$[=Wt>D$D$2 $[\$ D$D$ț$9Xpx2 뻉'U1U ]]uuD$!‹T3 $D$Z]]u uE2 E]Utt8uR $V 述t+@t%@tD$D$$uf`tÐt&$tɍv U8]u}}Ybáu ::D$ț|$\$t$ D$2 D$$VEED$ E D$D$ț$Yț$ D$] ]u}]ø2 sțt$ D$2 D$$2Vz\$4$`& :u2 D$ț|$t$ D$2 D$$U$$d&US$D$D$2 $JX\$ D$D$ț$}UE ED$ ED$D$ț$wXț$ D$\$[]Ð&U(]Éu]ۉt t-t$ D$2 D$ț$T]u]fJ~ʋ :u2 t$ D$T$D$2 D$ț$T]u]US$XS1KE ED$ ED$D$ț$yW$SD$3D$D$ ț$0T$[]ÍU(E ED$ ED$D$ț$Wț$ D$[ÍvU1(E ED$ ED$D$ț$Vț$ D$Z$|bU(0E ED$ ED$D$ț$^Vț$ D$iZu$.b&'UD$D$2 $UUT$$_Í'UD$D$2 $RUUT$$Í'U@\D$$D$U$D$ED$Ít&U Q$oQ$D$ED$Ð!U]w$h3 ]1]t& UM ܱ@t$$T ܱ@t$T ܱ$S҉ܱ$S(ÍUSÃT$$$賥[]Í'UVS  tW tRtd:t_8 tdT$t$L$ \$D$$5 D$$@ S u ut&:8 u:뙉'UVSÃt4ڄu)&Bt< vt< t< uvu11؉[^]Á=9$$Rc $P PP P H ܱPP(P  $T$b\$$T $ZU ֋ Åt$fQt$UQܱ AQ AA AA$ AA $(P؉[^]D$D$4 $ Q19D$D$4 $P B D$ܱ$`ܱD$D$5 $Pv'UWVSlN3u3 t t uuۉSU]QEA<_!uuAu_tuE0E[Et$OO$Q$2`\$$*RME5  (EEuU5 M=$(  MEM5 uE M=$5(C }]M $t @z}]U$={`$`C  l[^_]1Ƅ(f=. $F< DEUU܉<=E=_t!>Ät ۿ<„ҿt }> <&O|5<*-+}=F; mwਫ਼D$D$5 $L = u>uAu#t@t߀_ft؋MEUM@EBE E;0MuuEEo@>>1;EEЋM]ĉE؋EeʉEUu}u}ċUeUԀ#u_ËPpA< vA<A1;EЉqD$D$-5 $7K^KD$D$U$辕j}]$׹t 811ң $ U U܋u܉5l[^_]át$SJEUM5 u E =$5(D$D$E$FCv!D$D$5 $IEEEEEA<}$17(D$D$$TI{]EEUċEM܉$Uۣ   D@1۸??1D$$rME<]uPtu6E]D$D$u4$%É$ $H@\}<Mܿ 9=f  MD$D$ 6 $H*ZmP}&f:]EE|$$F5 觰= :Es= ]܅Uӄutv< t< t< teuܿ >=f  us}* _}|J$)YEDAu_tmڀ}-<-t&'U = ,u = ,tÍ&UWVS Cw,S&+& Cv)-uvƉރ߃[^_]ÉY= t!D$D$@6 $E1҃t É 5$$t$]hǡ(<$E [^_]Ã(tlCv1D$11D$ 6 $EE[^_]Ã5 =$t]s[^_]áhQK= )ƉtD$D$O5 $D룡EEE((E AvJE 5 =$EEE( E1҃(t $T$f (ɉt1$fC Q$BCD¡}t&'US !t/~t []Ӊщډ[]Ít& 1ۉڃ[]fUWVS,EUu}=  uofÉ ؉tMxeى!1tUE׉UUU׉}!؃tEEEU,[^_]D$D$[5 $VB}u&UWVS,"EU= *E/E}uR}uL%v{É։ }tCMUEʉEU;%}։uu}u}t%EU\$t$ $T$ZEUC9EU\$t$ $T$˅EUD$D$p5 $(AO7EU,[^_]ÍUWVS É֡ +ƒ-E҉u}u ؉[^_]Ít&;vt뼀}t)밍&'UWVS É֋= Gw1f vt. t= Gvσ ؉[^_]Ív t1렍&'UWVS rƉ:}uI>vet&K19׹ |9w11ۉΉߋ $L\$$>Eq\Ɖ׉4$|$^á($y;E؉$n;t$];<[^_]ÍvE܉$n=$L\$$>E}+EUt~D}/'}^}|EU Ɖ&}&}%} ft} 7M t&E؉ : (-(EU= :t!D$D$|6 $A:h  tp(-(u} D$D$~5 $9Mu}&;EUNEU떃}-U؉$B9D$D$5 $v9}*t&uŋUE։UԋUUuԉQD$D$~5 $!9HU UtEU4$|$D$T$ {ƉEU!!Ɖ+u}U UtwEU4$|$D$T$ (}ƉEU11ƉD$D$p5 $t8[M l1cD$D$p5 $38Zct&UVS\D$D$@$(9D$$@?t]t$x7t$g711E t E İ؉[^]ËEPËE օt E \D$D$$@"9İ؉[^]XUMt%19t 1 f9tXu]1ËX]Í'U] 8, XXXX$ X1USt6xYXuZJBƃxYo[]ƁxY;ƀxYûא&UV1S$ FX1t&1ɋXtXuމ t ctsF[^]Ív'U$]]uu }trt"$u']u}]Ã+t$~tك-t+u1-:S*w$6 -uy뭉$t& 럡t늃+uZ?{-fpc$?Q: U]Y: Z ZY: Y: Y: Y: Y: Y: Y: Y: Y: Y: Y: Y: Y: YÐU]XÐTUEt TX]ÍLUH1ʋ9u]fYUtULtH]Í&'UWVSÃYME~\=L1ɋtEP9t89Xuu&x u xt&u]tU[^_]Ãx u;Mu[^_]É'UVSÃt Tt@M 9Et2E9Xuux fuxu݃[^]fÃx u&Mt1tϡL@[^]Ðt&USeu t9Xu[]f ƒU҉]!‰ ƒU~]f1΃]!Í¡8USt%L1ۋHfBtË9u[]áL@Ћ9uX[]Í'LU Q9txu@ 9ut&A ]Í&U]ÐUYU9ЉYtt P]Ít&'USÃx$3Cx$3C[]Í&UY]뵐t&UD$`$v@Ít&UuaYuÍD$Э$<@D$Э$#@D$Э$ @ÍvD$$?D$$?D$$?D$$?Í&'UZ=tD$$~?ZfUD$$V?D$$B?D$$.?ÍUD$$?D$$>D$$>ÍUWV1S t$B*$D$2<$**\$|$$&2Y~" L1ҋt x ƃ9u|$D$$1 [^_]ÐUWVS }t$)D$$Q24$)t$\$$1=Yt2~01ۍt&Ltt@ u$9Y։t$D$$21 [^_]ÍvUWVS t$(D$$1$(D$\$$0x)Lt9z t;uD$D$${0 [^_]ÉэU1҉]5t&U]"fUSY9tuYщ£YtkLtx t-x t^Y@ ut"vY[]Ðt&YfuYڋ Y9uLx uJuL뎍'U Yt YtLt x t.vYtLtx ttɉYuYYÍUWVS uYLP9uÅt9utD$D$$. [^_]Ít$c&tD$$ /$E&t\$D$$;.Vyt&'U%@UE ]utrx$%$D$.4$%t$\$$-E11t$D$$-؋u]]ËE11\uÉ؋]]Í&'UWV1S Yu [^_]Ít$%D$$-$$T$\$$,Y~:1ۡLt!\$ |$$T$u 9Y1D$D$$,[^_]ÍUSÃ$C)t []Ðt&\$D$ x7 D$@D$$L.[]Í'U$' 辢tɉÍt&t uD$$`,7 tȺ`'UWVSÃlUM#}} M9Y+t19Y-D$CD$ D$7 D$E$5$LM܋ @Ef&EU9EuEӋu]E;ut(U7 u7 D$D$M $#}U$ T$*}}] LM`7 }@  $}`7 t&;u`tEEUG ;B tkM$L$!;R{')D$:T$ D$7 D$E$"G<t=tg]E;ut)}t#MD$D$$) L$ (FtU$T$!;uÄtQ}tK6M܋LE H u @M܋ 8|$E$s,&}ut-t E$ D$)u6U$$LM܋ Hl[^_]ËFD$7 D$D$ E$!LU`7 @ u7`7  MD$D$$8 L$ 'VW Ѓ#`<$iD$7 D$D$ U$ {$U%EܡLE@ED$D$$7 D$ &L#G<`$D$ 7 D$D$D$`$$)}UEƅ`$D$D$ 7 D$@D$$(IG;Bf:`L@@D$Y8 D$ $D$ Ml[^_]ËUD$D$$7 T$ %q`7 `D$D$ 7 D$@D$$'Doneut&UWVS,LSYFDt4$]D$4$ &D$4$%$5\$t$$1%Y1Džf9=YL40t@u؉҉uSLYu~ ttx u1҉b;Y5a D$D$$H$,[^_]Ãt4@ tA$28 F@ uț$ D$ $P ț1҉LD$$&Hi-,[^_]ËL A 4~}tt tk$uSu\$D$8 D$D$ ț$ țLL@ ț\$$ț$ D$A"LmY` ț1҉LD$$%$D$$8 D$D$ ț$xLT ț1҉LAs& ț1҉V0뵡țD$D$$8 D$ E UWVSLEEEEYZu}tE\$D$$wƉEZtt8r~ tu'}t E-YEME=BB uY}YE L1ۉU14M YVfM1ɉUЉE v9Ut=1z  B<u]؅t]ԅt Ļt1ۋ ߻9UuÅ:~ E)MMUM@ }uIu@}uK5Yu]t EȃL[^_]1E}t}E 5Yt$6t]ȅtdt$$m*\$$e$G8 cD$$ D$$D$$YD$$D$$D$$TD$$t$$ t$$pT$M~K14$$T)t$$LD$D$O8 $n;]u$G8  U܋MYF  EP@$ҡLUEEM@E܋z g|ZEЋHȃ)U܋M @|$$Z/IS$ӡLE~$s(8 <}ȅEv$3(U܋MF  `uiEE܋Mz "EȃL[^_]19U EUZF E랡tEBJ$Vu^|t$UСLJEEЋH LU4 LM&UЋB^U|B?$ LM$& LM$u"$4fLE{t&U$t$0áu 1Ҹ^3$t$]ÐU ؛U E]Kt&'UUtE;P t 1ÍEU ؛1Ít&'UW1VSà EC3t$$9uu݃ [^_]ÍvTUTXEu]]땐t&UVSx$$D$4$\$t$$TD$Tt$$t[^]Ð&US@u؋$uD@H[]Ív'U @t9Au&9Bt ыu1Ë9@tM9DtNHHu#D@$RÃu@D@벉 D몐t&UE ]1 Y}}uu؋u]}]Ít$o$D$$D$$D$$D$4$'\$t$$Y|$$Mx=Y1D$t$$BU$D$%"$D$"$D$!D$`$!D$dY$ UT$$-Í&U5d$D$!O D$$É'U(}}]tu$ D$$4$ t$\$$11҉tMD$ ț|$D$T8 D$$ t$D$$o]u}]D$D$ 9 $|$$뱍t&UWVS Yu [^_]Ít$ D$$$ D$\$$t}Y1ۅG&9Y~5Ltx u5H9YfD$D$$V [^_]áY1~=119Y~&Ltx u؃9YڋY9=Yu Y1ۅdt&9YQL40tރx u؋u1҉u;Yt);=YL0H1҉A;YL5/YGY 8'UWVS,uxMODžp$ D$$$ D$\$$1҉MNjE L`tlP;YE $D$tU Lx D$D$$(,[^_]Í&P;YuXE9X{ t{uE D$C$C u} }  L뮋E 4$D$s,É[^_]DžE 4$D$'} t[} tUx } ?UL`H1D$C$PD$@$U L덍v'USY~`1 9Y~QLt@uD$@$?Lx uD$@$9Y[]É'USY~`1 9Y~QLtx uD$@$ LD$@$ 9Y[]Ív'Uu!YxD$$\ ÍKYxD$$UPt-;Yt%D$$ PD$$ fUWVS L<H9tt&9up;5A1=X]CS9]ut$<$#u [^_]ÍD$$L5Uu!t= t|Ðt&!t= tIut|Ð$3t$t$=u$D$$%USYt$D$@D$$Kx1[]áț$ut׋Ȱq$^8 \$D$詰fUYuț$t#D$@$x u 1ɉÐt&D$D$$q1ɉÍ&'UShYțYY$ Yț$Y9tD$D$$ D$`$=Y$m-D$jYoY[]áț$r$D$D$Y$ɿYYuMe;YtQD$$D$$2 \$$Y$YuYYL;YYD$$Y;YY;YuD$$YPD$D$r8 $K$o'UYb&YY p$T9 躭YYYP$D$YYD$Y$E$,9 `$ Y$D$sYYYUYt$$Ív'UWVS YEu ɉE ELU<YU9=Y9=Y$\G@)Y Gt$_<$+YYtf Y5LYE9Yt9Yt [^_]Ít&[^_]YYt&YY뫡uXEUEL< _D$D$t9 $\$UT$$UUE1t[@[$ ‰Xp@sDDH;YHt&L2@$@H9YH|čt&Y-Y)ЅY'YYYэP!9ʉY_YЃ!9B9.…y܉؋YAY9|K9u69B919!‹t(LTtvuuft c9Ή5T1R$  T9xDž‹9uTtt$tGыu YPTɉGPGw11ۉ1z  1z 9u1]G $' Tg~$&$\$$E  GGLG<YY5Y=YUtNtG=Y GvAD$D$$Y,[^_]ÅtɡYOtGtuD$$뚡YH!9LuB9uЃGY1SY!‹YY9أY~1)؍9u9t$(Lt 5Yt YYt Yt Y99~T$D$$MYuL85YJ9ΉCYD$L$ Y9ˣLn1)ِ9uQY$ 5YL~1ҍt&9uYYY-EGYYu<YJȃƒ)t~t$D$$4$t$\$$9Y$5L YY11ۋ=YDžDž#99t9ủ$8 "$ LiDžl ufYdL11YDžDžQ5Y1/UTtYP訶 Yu$Yu$8 oÍ'U5YV$ $ÍUO XUt]f]X UWVSl$DD$$D$$<$|$\$$UtU t~$qfZ Zt&YRPP4$D$(1҉Mxtx \xRC $ TɉʉÉp@@ ETCu‹9uE 5Y Z~e1҉MɱtRLx D$D$l: $h\$t$$Et @)5YYYD$|$$a[^_]áPYP;5Y*Y8$VD$D$@$Y4PuPP;Y訴P$D$KE u&P;YtuD$$;PYx$YY}YD$|$$8t|CD$C$8: D$25Z29* Z5P+9 Z=Pu YP耳YM tY[^_]ÉV;YY$8 變Tt{GD$${FCP\$$8 D$R>U1ɉA`t u tt&u]ÍvU1ɉStXA<;v 8[]$: ;(u[]Ȑ1:؍U1StYH߃;v 9[]$; ;(u[]1;'U1]É'U]ÍUSÃ$u @[]X@[]Ív'UVS]$!$ۉt; t4 t t\u u[^]É'UVS]u;ubH9r/K t0 t+t:u5AQ< t< t< u%9s u€tɃ9rQ؃[^]À{Ct{Ct$+|뭐&Uuu}} ]4$1Ҁ|)t]Ћu}]ÍX\$4$D$UV1S`t$ڭt$$莦 u׋t!C$谭t$$dۉu߅tt 4$ ƃ[^] US1ۃuJt79~,<t$-u[]ÍUSU E~XtFщƒ t7!ȃuC$}$.] E[]"1[]| w`t$?'U]ÉuΉ}<@tT<*|$*u1]u}]D$[$EtP@tW*uπx]vuƅu{t&ut tEt^E뒀{ztqx]r뺅ɍtEvRE1D:UWV1S҉UM::$ËE*l*KEtEux*1*=|$$Ѓ D$^;]t$St ?}}f}mEu\9}rUfEt=];=t$Ѓ D$U$x9sƃ9us1[^_]Àztzt$U:*WUAGE1<$Ey\ٍvEAl9}c]9O3=|$Ѓ D$U$uƉE U:]|*?9}s&9]=\$Ѓ D$U$suϋUE UE U2[^_]Í'UWVS˃Ut8u>}Y<$<$|$$[^_]Í@EtGEt<$E띐uu9v 뙃9w=t$Ѓ D$E$qt<$;}vfK9];3=|$Ѓ D$E$tĉ$G$\$$[^_];}v9uf=t$Ѓ D$E$t<$$|$$]9vk9\3=|$Ѓ D$E$5tʼn$h UXueE1]Ӊ}t&>uG4$#$t$$ƋUe3]u}]Í&t:t&E܉\$D$$[Et$D$$;EЃU܃MUMUĉ$t&EMEM$E܉$4$(ƍ@$UT$ t$EEÍEމD$$E$E܉$Q11EЃMȉ9lj AMă=UL$$EЃ D$ tMȉ $Ets]ЅMč<=|$Ѓ D$E$tˋUċ$;E\11EЃڃ9d=MЃ D$E<|$$8tEċ$E.}ЅEčŨ=MЃ D$EỦL$$tỦ$bEUWVS,]eE1EuE}E EӋu}UT$ \$$D$tBwƺu}빋Ue3Eu,[^_]'UWVSD$ T$$D$[]fUWVS,EU EEU88ut E8EUB$jƍt&;]C$NMۍ4uۍF$ENjEEt&MA$<$\$ƉD$EEt0U9Utȋ]t}~[ML$E<$D$}E,[^_]Ex)Ex$EUPC$e@$Q$] E,[^_]UED$7 $WÐt&UU]uu1ۉ؋u]]À:tE $D$ t؉$4$ƐU(uu]] }tM1E>uNEM)9}oU؋ML$t$$cU4$؋u]}]Ef~tEf~t4$%ljE끍Ѓ))E$L$_&UWVSlEU ]҉EPU :D$@hEEt M9E;E E 8w]E@E螿QE D$D$E$.UED$E$T$EMEUMĉEU $Mă9*u |*tX $UĉË**KtUăuz*N*=Ѓ D$M$L$;]ĉt$ }}AE~E1ҋEUЉE‹EuU9]M ;uv= Ѓ MD$ED$Uĉ$5uUMU̻E9EEEM9ytyf$-ƍD8$E}\$E$UT$E$]1E@M9uMEl[^_]Ívqt y;EsiUT$E؉$NEl[^_]EyEy $YE$If;Er!E@tUzu;EsߋML$E$6E`E$跾vED$E$MU EÅt_]E+]E9E~TurEEEEt1}u*U;U EtU:tM 9$v]E@;E}ED$U$}ۉEt\$ML$EE$!E]rED$UT$EE$MMK $C11҃=Ѓ D$E؉D$Mĉ $WE9u1ۋE$WE$LE$A$t$%E\$E$EEUȃ9$뗃z\ٍ{UEĐt&+cuX]EЃ5=EЃ D$UT$Mĉ $FuUMЋ E:EUUUT$M $)\$E$ $K$AƍD8$E MUEEevUWVSEeU1҅Du+DžP]e3Piļ[^_]Ét< >  $=ЃTh$9Y5PLu YPCY$D$YHl蒇5PBlD$$D$D$? $謺$`c$}$[V{H5PMl$hDžPۉ\111Dž`4E uwti vPX``~HXtۍG9|9}Pt$$E PtP딋\pD$\$$4`~2X놋PPC8:땋Pt9PtP$螸DžPh$膼HZ$莺HLZY= PD$$xE tq~;PP|; t#t&~< u<:u)=fkD$$ LGD$PD$$qD$D$t? $訷$\`h$Bl$4DžP{wfϻD$D$H? $C$_뙡Лl$9t<؛l$9t%țl$9tl$薺Лh$ò9t<؛h$謲9t%țh$蕲9th$C$ u DD$$uVudTtD$> D$D$k -t‰w$ܽt u׋D$$ 葽t@믐UWVS\EEUeU1҉MEEE8'EEE؉Et<uYE؉Euu̅t Ẻ$U\$D$E$:qUUe3?\[^_]9uU)މt$$Eȉt$D$E؉$轺vr}̅E؉D$Ẻ$(H˱t&vtEUȉD$ Eu}T$)؉D$$艳@vIt=U9u zE|$$Swu}UD$$T$Ht p$ht$E̋EỦD$$xEEf述UE؉$T<utL<'tH茰viE܋Ut$$EE܉D$ )؉UĉD$L@vMt0먋U\$D$E$ oU>uE1i5EUĉE܉UP'UHEeU1҉]] }}uEu'EUe3E3]u}]Ë0tt̅ E]Ev 4$E܋U܍M$BEtEE#< < < E]EcEU\$ $EЋE)E܉UԋU܍D$T$袰@=U] uf]Qt} t t fu €u҅t\€tP tK tF t&ttz<tv<~t&tn<'t <\t<"t&uE覡EUt$$EЍED$ E؉U)؉D$a@v[tOf&U1<$T$Uȅt$$Ue3uW<[^_]ÍvEЃUԉEU]܅tEt(<$蓥$D|$$|ҍEt|:HExtx8Ettt:EEEӄۉUtE1 !EEU|$$EED$ EU)D$褝@J42U<ӄۉUuU1++EEEE0Ue3uĜ[^_]ËEEt }#q}7}\v*Eȅ~|:UE̅tx:Mąt:`}'r}"h蠚vGEU|$$EED$ EU)D$_@EUfE<2f?vkEU|$$EED$ EU)D$@t-42UE<vUE<EE<EUEUU<UȉD$<$T$ݢUȋ|xE؋E$D$tD$EUju؋E<)uEE}<'[E܋U|$$EE܉D$ EU)D$迚@R42듅tUD2< t < t< t&菘vmEU|$$EED$ EU)D$N@9t/42UE<#UEƋE< EE<UEEUUE<D$D$? $}UT$t$T$@D, EzREzA$E1ExEx$ߛEEzEz$譛EEĉT$<$D$2Učt2NFe<E؋EU؃$Eu؋E<$ËE؉D$EEU$T$E>ẺT$<$D$蜟dU̍xE؋EуD$t$D$UEEUUE<EUE܉UE1ۉ0y'UEM UE 7) EE> ]'U> U ED$D$pS $> ÐU> U ED$D$7) $> SÐUWVS˃LeE1UEEEE4U؅<\pM܅<`!E辔AEUt$$EȋEU̍UT$ )؉D$y@4sUe3L[^_]Ít&?EUt$$EЋEUԍUT$ )؉D$@E<`<$<" ǓvNEUt$$EEUčUT$ )؉D$膕@ EUĉEUwoE`EQEBD<(t<{bCE|(tM1ɉU$*]EЃUEEUEȃỦEU> UD$ D$7) $> 랃Bϙt&'UWVSlEUEEEeE1UU$ E̋E$u E 1EEr9u EU$EED$ ẺU)D$ED$Փ@42E9u ]ąu}\MU:'"}&oveEU|$$EED$ ẺU)D$.@xt'429u eUe3Eil[^_]Ã9E*ET$<$D$+Fu+EȉEEEEt`<'菐v~E܋U|$$EE܉D$ ẺU)D$N@~t@42U<2u;u oEEUEEUHE<0[ỦE;u "뱃;u t&럋UEUUE܍<2EUEUϖt&'UWVS\}eE1EE<$M ɉE1El9u 6EU\$$EED$ ẺU)D$@42E9u Uȍ7u<\D'"a詎f.EU\$$EED$ ẺU)D$b@E429u x1Ue3=\[^_]ÃE<EE7t^<'viE܋U\$$EE܉D$ ẺU)D$贏@t+427u;u CsEEUEEUlU̍N ;u T똃;u FvEUEU*EUE܉U"&'UWVSlEEeE1U4;4$`EEEMȅ\v<$<}<`'6"-:vEUt$$EED$ EĉU)؉D$@tK4;N1E=UUe3l[^_]Ãmtу4;4;E}vTEUt$$EED$ EĉU)؉D$<@t4;Et&4;Ev]EE4L<';ۊt&]E܋Ut$$EE܉D$ EĉU)؉D$蒌@z둍vD<{tx<(C> E؋EUD$7) $>  D$a]؃4;UĉىÍ48EU4;EEUgE4;XE̅5D$D$? $|$D$S $G631EU\$<$D$RHsCe<E؋EU؃$']؃4;U1nEU4;EU~EUE܉U1'UWVSl] }eU1ҋEEE4E4$jEEEMą<\Uȅ<`!E`EUt$$EED$ ẺU)؉D$@_4sUe3l[^_]ۇ`EUt$$EED$ ẺU)؉D$薉@4E<`Ѓ' "v<$uDL<(tz<{tvT$U$.-EUt$$EED$ ẺU)؉D$@EU4EU7]؀<9(>1ɉU$]؀<4t&4E4EEE4<'t8v?E܋Ut$$EE܉D$ ẺU)؉D$@vlt뤃럃4E@EU4EEU"EU4EU U̍KfÍ4EUE܉U-> UD$ D$7) $> r|&UWVSlEUMEEUeU1҉MEEZML]E1EE$舉E؃$6EEEЋu>txEUEU袄U؍ED$ t$$T$kÍ@E<;Et$\$$u])]>uUEMtS1}EȋEE̋]1< t< t< u%]t‹ỦD$$ù;u~EUe3El[^_]Ë}t EutNjUE뼋EUEU< t< tUM UmMЉEEEEߋM̋E|$L$$-9ljE8uuME|$L$$AÉ$LUUԉT$$M$EFE9}| M9MEE}t }ZtRUMӍ| D$Ẻ$>Eȅu< t< t < fu}t }}tMU }tUċEuԅJMԋ= $n>E- EEM}U:EEU;U fMD< tU< UL$:SMԉL$$LEEԋEE>G;E;}Mԋ$:S\$$KMUԉMĉȃE\/MD$ $UȍGEtyuU\u/< t< vt< E[D$Ẻ$@ue}v,UUčt&uuM\u6fE[ UD$$uu&UWVSlEUeE1EEUM$yM)؃Mȉ$]EEE;EEЋ]uԅM"tE̋U\EMEU\$$EED$ EȉU)؉D$ƍ@2ufỦ1UЍt&9w]̋]EHMЋ]Ue3E8E?l[^_]Í&\E؅tp1`M!E؋ËEE܅^@>~M̋]ЈME`tM$tg"vE}uZEKUMUM]̃E`]EUMT:UD9<(t<{3GEE|8(EU$vƋŰM $UỦ׃D Et1ɋEЋ]ȈTT1u UE] }M̀<:uES4$HFEM̅2ݹ> UD$D$7) $> :SsEKEЃU菃t&'UWVS,E؋EMԃEt :{G1EE;&EtMU9t$[~bUu f4$FNjE tEt E 4$kn}-ts}+tm<$t&/$|$$؀É$$}U؉$tsED$t$$z4$}E8E,[^_]f01>EB7UM$IUD$t$$닐t&UEj$E܅t}u14$1蒜UJUWVS,EU e M1ɉEԉÉE؀<#uع> $賳EUԋ]9C9]ʄ҉ $|{|$$L%]t E${Mt U$zM $zUe3,[^_]ÅDž0#3@\]0< 0ET$0 $RH$U@`iEE$J,1ۅt <C<}6Uԉ$zEEԀ<}nE EԀ|}]0< $)t&0E,PE1EDž@$fE$!Ex<#f?vZ@Q*Cv$@$3V+EEԋ4]E UẺD$EȉH$ENLH1U$)x]t M $xMt E$x@É0>~Hf8EZUẺD$Eȋ$EU`(NjEt M9/]Dž|$iy$\$$zE: < 1U;/u<<$> T$T+EԀ<}EԀ<}vuMD$ $; $脬$Nw$EEԋUEԀ<!VE\$$w$t]vLыDPu _FuعS $EA<!O<#0j ^ li5E܋Ut$$E܉D$ l+pD$k@ pwD$D$> $kUT$$H lMUJDPu _$Am${\$$m$ mD$D$D$D$ƋEԀ|*4$L$蟿tt t D $Nj4$Fj$>jEԋJ3É89EUD$ hMt$)؉D$$pi@[EU| |@'1ERƋ|EUL$ D$T$F$Ӧ2ۉF$X~6u|``(| E$2ƋM $uY| 4$4$h0D$D$$@ $ iML$$E$hU$h˃Dž|M^tyt#B< w $u$|E9ƋE׉$,hEԅ-014$|$2H1Dž,Dž4Dž8DžE|UD$ẺL$ T$$ãuE̅t$RfFE|M9D$D$? $bfUT$$/M $eU$e|UMD$ EȉT$L$@$7XE$_Et U$qeEt M $_eE$OeLXi8fb`Q`8BxfDžPDžT4$ںk\`K1TSPPT|M PTX\$tt t ut U$d]HD$E$UL$+M $cDžPDžTp艔ZC SPT $D$3Ɖ$cD$E$D$b $.c4$SU$cE $z]=MT$ $LƋÈ8@M $bEԋ+É0EHEUPTLLPD$XL$TT$ \D$EȉL$T$@$̤cEh`J`:;zDžPDžTz$dDžTPPX9tYEtMEt399ljEM99}㐍t&14$4$a$T$6x$$E=Q5pU܉MD$D$? $`ML$$ E$`Pp+uxډt:ttw]vNE܋U$E܉D$ l t)؉T$D$_@vt덃눋 E܉Unpx\$L$$2ÅuE̅t$_uk$蔔Ɖ$_U$轋DžTPDžlNUD$:$T$n $ۉuPXẺT$L$$w@tt UM9*tXuF$讚9}tE8U$NME $f`lU[fu#t@$H&$.r&'UWVS}UUEEe]1ۋ]Mu UUEPULA4$%EPY<$I 4$4$Ytt =U<$T$ҭáu tEUU]T$$œ24$1uXEE4$|${E]$KD$D$$\48t E8$]EE1E$E!Eٻ$Ew$~EVÃ$Y$xh\$$pZ$YEЍ8)tq<$PW<$OxE$MVxPMt UU3$W $ʆsUEE҉U1Eu<)<'<\<"}(TvZEUt$$EED$ EU)؉D$U@$t;]<4<(uE뛃myt&EE4t<'tS8E܋Ut$$EE܉D$ EU)؉D$KU@4S뙃4>BSMEUt$$EED$ EU)؉D$T@EUEUvEUEUUKoED$<$ݱ<$T=[$裄ÐKEUE܉U UWVSDE@U <=DCt $ } 9U||~D C~DAla||~P AE|BÈ| (E#<`<~<\|| , |J@M\2u@ڃ@@tÅ^ AE<$<'O@{BẺEEE#N]̋|؉$R4|<'ME܋U|$$HE܉D$ )؉LD$O@@B1ɉE̍ỦE|e} E;1ɺEƍE$D$=p'=4$>p p4$~Ft @. ]t08Et 84t 4p;uȅ D$$Njp4$!?~Et;tbD@}ȅ]8u7 tD$D$ $裞p|EȅgEąRtF4$HD$$D@p%KuNt$O@HDFtHDfzyHDA tH DC@tH@MątHD$$pBEJvmJfUE$\U䉅XẺT$ U)|T$D$sL,,$]G11ɉ0Ẽ|0T;,Er܋,0F@DC $B? E<<T$|ED$1$EEE̋EM9t 1M $K4t 4DŰ@EF D$EĉD$ EȉD$ED$4$|= =U 8t u?t @%8$n:11?tftfE+x9}Bxxtt$|$$Mt3<$Jxx tE))EU $T$Zt녍Be<E̋|UU$́=E=4t 4DAE̋|D$E$D$oËM߅U$I}Džpt4$IUe3p[^_]ËDC~ @uE $D$|$Da8E|$$t 8~$IEED߉B$H1}4$x4$HiBE0FvŰ|р9$wYNj|EGGE̋|< E$4YDž,E8u4$K~@4$D$)}$XDž,E̋|\$D$ $?}Ɖ]"E>w!|x;]}&xt D xzm;]}UtT$ $tWt봋t$nDAtHDf{yHDF tH DB@tH@@#HE̋U9UH<$HƉVPTDž,]uE̋|E<eYX\Dž,UM-BEI4$E}7mE]D$ EuL$h)ЉlD$$#E,*,1$sVDž,w11ɉ0Ẽ|0T9,Ewp#v$+Ef1"E'BZUẺT$ Uu}$)|T$D$7DÍ@u$U1\Ǎ@EDž,Ũ|,$U2$,9ˉEw"? OUPE$9K"1>Eu+ED$@D$DED$$ T/dev@/fd/@EЉD$D$ 4$D$fD$G$Ft;5|j9@=v ;5~FD$$SD$)ډT$؉$A0 PYY$MUPD$$\UۉPp$.]Yu4$lFp]uDž,$FSuZE?UE$dU䉅`ẺT$ U)|T$D$cA, ,uDž,$1RHM1ɋẼ|u9,Ewڋ,2]1|E<$6Af޿EE|$ At$@Džp-HLU܉Ma$ C$Q\$$CpƋBX$0uA޿\X|$r@t $d@Džp>u ~mx;~v&D$$"H$@<$ @u}QD$D$D@ $#@$`dDž,UM|$@ ЉD$|4$z?t$l?}Džpt $B?|$4?4$._D$D$p@ $U?$ <$1>4$BM $BSf{wv-q? % ]P1*$E}É\$$?y8D$D$@ $>\$|$$^$F9]t E$6B|t$14|4$BUD$D$%? $蛔$'FvUWVSLUE$]ẸEEE̅Kt$-]Ӊ‹B@uẸ&C$苝u,=u5$+vu$H-EẼL[^_]É=UEE̅EI]184$jtt 4$Ɖ|$4$NjE̅]̋E̋PE̋B%=OCU1ET$U$1=/=YMgC@Z葐4$G,JM̋XEEt&ŰUD${ŰB$ŰB$xE6ƃE3E؉D$U$UE؋$B;u$ EE̋x:uT$$ CuGUB뙉$QD$C$S bwE؉$+Pt<$t Et `<$ jÈ}M̾Wt4C$օupuѡ$a*EL[^_]ËCE؉$8*<$0*rCU$*<$)rru=$t rD~r5rrf@ZrtE4$7$Ft$$8U 1D$$EE=tC=t 11&GE4$̓t@%$"/$=\$$/$D$$"`$h4$,$*'X?t&tU$1<$1.fz]/1ɻU܋Z r11`Y$T$!OJ$\$O뱉<$1W]܉D$T$$aE_?]f*1<$1-4$1B+D$D$B$^a(v4?u 1a<$1%WP?vt1%<$1,EE4$fEE$'USEu 1ۉ؃[]À8tU tы@tVC`$Y؃[]É'UE]] u}u1ۉ؋u]}]Ít&:t11D$$tȅt:É$e\$Ɖ$24$])<$댉$X<$Oet&'U8uƍE]Ӊ}ωD$4$,4$8+$9E$@t$$+UD$D$ D$D$$$(]u}]É4$vED$|$4$gvËEuXtT;t f$2]8EU$T$Jt8tuf4$]É4$'1Ɖ_4$~tXtߋ@uը{$D$D$]X$~W똉$rW똍&'UWVS M?DžEtp$UƉ$1M'<$qE MU$>Jt30< v@~u ^u91ҋM4$& [^_]É6Xf4$8t‰$1M 1U $MI뷐US]$&][]& USXtUtLD$D$E$ øt$Ct$C$&$&1[]Ã1[]ÍvUtD$p$ Ut$@Ít&'Uu5X]]}} t~ D$$D$Ƌ@ta$K%^<$'$16|$$)(V}ЃB?/tJEF]u}]Í$,'$5\$$'F$5Fst&8t&'U(}=X]]uu1ۉ؋u]}]átD$D$$t΋@8@t[uހ>.u~/tn4$o&$ 5.@/@t$$ '$@v$#?.tI<$'&$4|$$&C4$&$4t$$&D$/<$"u <$%D$ D$|$$T /tU1UtB] UES1tiÓJ1Äu[]ÍvUE$‹E @Ƀ!UWVS }u t3Wt,G~%EUut$օy [^_]ÃEE9Gt&US]$p"][]c" UWVS u} EX~H~mEMMu#9C$׋C$!$!t3uًC$!ԋUMEUM9QE@ [^_]Ðt&UVS]$ 2ۉt:$t2ۉ^F~19|[^]$@82F@FU(uu }}]u1ۉ؋u]}]ÍFt<$EF#EEtE ]tËE;C uS:u|$$(uӋ}tUnuUUWVSU }EtqE<$U ƋB!EUu 5t&t*;s uS:u|$$(uۃCt&Eu 1ۃ[^_]$0UËE s CC{؉U B[^_]ËE @@룍U}} ]ut}EtXE$)w$!C07‹Z BGEBB]Ћu}]ËED$|$$u$Apv'UWVSuE UB$MYEEEMUEUE<$[/ƉE5t&$U FG F G?Fto$#/Ƌ_$X $ /\$$!_F1tM u$& $.\$$ |EUME UE9BMUABE[^_]ÐUS~. 1ҋ9@ @@@u[]ÐUVS~O1$@t$$95t$[^]Ít&USÃtED$$yu*Ű E܉AEA EȉQAt[]Ít&@ @@@t[]ÍUWVS$@ xEt%$M$,UT$$E19=|9tՋp ED$ $xw}m]9ufpuD$|$@ T$HPMMUL$$axE;ExVP@ D$M $W$ 4$ UXT$$w}f9]Ѝ&D$D$A $|$L$D$1N}E ETy@EЋUAE؉A EQA UthD$E$@ D$kU$Č[^_] U;Uzt&P@ 91k$@ rČ[^_]Ãy@؛$ D$' `9+ɍt&D$D$@ $BE}]D$D$@ $EOvUWVS|$U=E~e1ۋ5E9tTU8uU$T$` uمx0ED$E$uU$35G4$4D$v($ã(3uE1t%U$$(UT$$C|[^_]áUċ EԉAE܉A EQA@v'US PT$ $L(f@l/var@/mai@ /PTD$C $#؃[]Í&UWVS$1 }EQtg|$4$Otl1Ґt&t t1҃u1҉$<\t$=$ $ D$$$D$$$= D$$#D$$#=tN uD$$#D$$#=t* à 멃 $' X ͍vUt tt=t$ UVSt!Pt1 t&< tT$փAtuިuAu0u%% 4u%[^]D$$R"U`]BfUP]2fU$Ét$tI4 Ѓt6࿉t $t$]밐t&Aȍt&US]$D$!1Z$[]ÍUS]tAtBt Ct&u @tu$ue@uatc[]@ׁ<uD$$ $D$ <u 듍v[]D$$ 닐&US]tRAtMBtHCt&t>t @~uct_1҉0$DCw<t2 ƒt []ÉŁ<rD$$$D$<A 4t&$D$/&UVSD@‹t@u Htt1ہ[^]Ð1߉ $m$HT$$LD G ɉTP@LD$D$$_dP $qBP$ D Ѓ TT\@D$D$  $ D$$  \D$D$$ D$$ H$ D$Dt&'U5A ]'USQt []ÍDA C[]fUQt]]PA BU1҉Qt ɉÍ&[A AT¡tރu١t@D$$  'U]]u}} ABCu=$D$<$Q $|$$ ‰u]}E ]]f<$ $|$$ ‰xt t ]u}]Ë]u}] <$ $h|$$` u}‰؋]]D$$7D$$$< p'UE$CD$GÐt&UE$BD$'Ðt&UE$AD$Ðt&U$tËE$D$Ív'UECw ZtÐt&D$D$fA $ fUWVS; At鍅t$i$[t|$$ D$tD$$9 C ;B $ $O\$$G D$D$O8 $^4$<4$D$D$$ A[^_]D$D$ D $\$|$$脯 z<$D$D$TD $\$|$$?|$$.t&U]]u}@N tCt>x 8ƃtt= t>>(D$D$|A $\$$#]u}]ÉD$$UWVS,ED$E$uEEEE9uԉt$E$ taEE؃UD EE؋U܉EUE ZEtt&~@C CCC[]á$x$룋CC u K뽃K벍t&USu[]Ít&EtC +CuC1C []1؃D$ D$T$$) ōvU]]ut%C3t$$]u]Í&'USEt$][]1[]ÍvUEx,;}tt UE{ Ðt&USD$$ 9ˣ}1)ِ9u[]Ív'UWVS|}ED$$|$!D$ D$D$<$xUċE| | t_4$$Ex;=}Ds;CECC CuC|[^_]f뛉v= v&q<$1č&'US]$tE \$D$D$`D$ $];[]Í&UD$E$x Ez1ÍUWVSu] 99;=EljE׋2t@t ;A $<21Ut($D$<$ƉD$諸ME4tuttqMH[^_]Ít&;/ =E*19ER1ۃ[^_]>$|t&UVSut4$Q] t8D$D$D $\$$1$q=095Ut%D$D$$[^]Ít&UD$ D$4$PD$D$4$uD$D$D $Qt$$낉$4$)Gt&US]$t~D$$t1[]u$u&'US]9tdt` []á$ $ZD$D$ $>ta8u t[]á${ ]_USL$$Љ[]Ít&UUt]1ɸ뷍&]Í&' UUt]1ɸ0농]Í&'UUM ]\UE$D$Ðt&Ut]11Ҹt&]Í&'Ut]11Ҹt&]Í&'UEt 1]ҁ:]Í&'U0UM zÐ&U$ UPU PÍvUE ]}}u0F$ á{s CCt$|$$u}]]fUEP@T$ $D$Í'UtU]7v]Í&'UEuD$$ uÍUVSuu$wtTC$҉$tUSңuЅt܋S:u҉t$$u‰][^]qKSC T$ $D$뙃[^]Ít&'UE E]I'UVSuuI$t7CuS:u։t$$uƉ][^][^]ÐU<[]ÍUWVS u4$$E t>t~1tg111v;ȄtAuE t|/tE tD$EuD$ E܋}\$$)؉D$@vLQ!ӃD<\t<]uE1cv,u;tt&뀃Eu}1;U]ÐU8E ]ulElp$[$ME\$t$$:]u]ÍU$D$uÍvUD$$V US ]uftet t_]u6D$$\$$:[]Ãuv$Bt 넍&UEu]]*v'UE$D$[&U,tI,u-xÍ&'US1ۃt1=ƒH !ѣ ,tI,uYD$$=D$D$@$L$ 9uHu{t tit$guU$W&[]Åt؛$Mț$ D$hț$+t$]n*&Uu u]]<USu Ĥ[]Ít1E$q tӋ`[$bu㋃`[$puыd[D$ph[EpD$`[$ 뚐t&UWVS,t ,[^_]Džhl1E4$$`[ 4$D$_u0ۍhv `[$suߋ`[t$|$$Md[`h[u d[tT`[ud[tt D$t$$o,[^_]Ë`[|$t$$`[$놐t&U $@D$@D$$xD$$@D$$t-D$$D$$ziUU<=tg<tRÄuFQ<t3<u؋E[^_]Í&U1S]t\$$[]É'UVSutGVB 9t&X $V9uRR FFF F[^]ÍvU(}}]M uu1ۉ؋u]}]ÍG WEU tم~ՋwV 9։Ut1R 9t99tnBˉr@ V ) ZR 9u)M]E)OU_EG ]Wj`UZ $ۉ]uHEMtt&:A 9u]A RR GGG G<$1zt&UED$D$$Í'Uuu]}u]u}]ËVu1F FtZ 9tאC$ENjCt$X{[ 9^u뭍&US]t"$C$_][]f[]Ív'UE]u}Eu1]u}]͋@ BtߋBp 9t1VT$$$|$$Ӈ$荿Ev 9puątt}]u}]`yU}}]uu1]u}]ËG GtGX 9t1t&C$蕎t$$I[ 9_u߅t8tE]u}]xUuu]}u]u}]ËVu1F FtZ 9tאC$NjCt$舾{[ 9^u뭍&U8U]u}u1ۉ؋u]}]ËBtB Bt$Nj@X 9tBED$ ED$E D$C$`ƋCt$s[ 9_uE tg<$&E@ft;1҅tEUED$D$<$rÉ<$X;D$D$7 <$K׉<$뗍'U8]]uU }Muۋ}t CEu1ۉ؋u]}]ÍvC Ct9K|ߍv9SrՋE@ E؋E9EtċE;H|;E؉E܋E9Et6|111ɋE؃@ E؋E9Et9| 9֍wًE؉$D$E܉D$8] tu$EtumE EED$D$4$4$ E؉E܋E܋@ E܋E9EE;H|;w݋E܉E-$!1҅tU넃Dft&'UE]u}u1]u}]ËMQA t$UNjB1ҋp 9tRE&^1t$製$T\$$LMv EM9puhUWVSLEeU1҅Eu1Ue3L[^_]É@ At$(UƋBH M̹;EEM1[EȉD$$腽MȅUȀ:~ztzv0]D0=UăEЅt3Mč$L$*M19tyt yEЋŰMB ;At E0 EЋEąt Uĉ$ܹM̋EI 9HMM̍ED$ D$QT$$UEEȋBt $DEĀ}Et$}E t}E ]ątYEĀ8tQUĸztz&]E9s9}4$|$kZt&11]ЋMЃ9| 9}4$|$-MЉډ1)E 4$4$蕸Mډ $úE$$谺G$裺 $薺fC UVS0] $-ƍCD$E4$D$IDD$4$ÍED$$$EU۷4$ӷEt EU0[^]l$@U(uu}} ]|$F$\t6D$ D$%$D$\u]}]]Ht&J t+D$ D$%$D$]u}]øJ ΐt&UWVS,E] eU1EEE$EE^EuD$ E}$D$E؉D$@vat?)UUt.<[tB<])E܋U܅twU؃uҋUe3u,[^_]fEÃmu}ںU]]u}D$[$>)؉ED$$NjE9~<;]tA$`} tM 1uu1ҋ]Ћu}]Ðt&E1ߍv$蹷$j\$$b[] ۉtM FMtE+}8땋E t E ExM1j&'UE]uD$E D$E$u1]u]Í&$ $貴tFtэt&ɍ&'U(ED$ED$E]] u}$eu1]u}]ËM@t*u߀y]u@ua$1 D$$X|NjE8*t\$<$ Ɖ<$Xt<$ É$$ٳӋ@$u\'U8uƍED$E]}}UM܉D$4$ËEtiU<@t@<*tEU\$ D$FT$$+6E U4$D$T$ËFt‹UM\$4$T$L$ Ѕt$k[^_]$QGGUWVS,E] @EEK}WOUMtOދF@t;[tEMEU}Gt L$щ‹E$/EU6u,[^_]D$$ǍE܀8]tQ}E\$|$$UËBMU\$L$ MT$ $Ѕt$D|S M<=t <+u|;=u<@f<*|$$M9+]܋MEU$VEEUE\$ T$UD$$EEEEu[hD$D$J $袬\$$rV$UWt&t|;=>M]܉EU$'UWVS,}?(D$J 1D$<$6t+ËCtt t[t/u4$uÉ4$;}t<$菫,[^_]D$=$tC$褭D$TECMtCE}u [tL]tGt=u܃EuC$CU2\뮍E1ۉ<$ED$%UE uu}}]t*t$$t$<$ÉD$6t$ʚ]u}]Ít&'U(]]}usvtt$ D$D$$Ct$ C{C Ct$CS`W`WCC؋u]}]Í'U]]uu $Vt8u@t]u]@@t@u&1E]u]]u]]$S1뵍'U]]uu D$E$[t]]u uE]0]1u]Ít&U(E U]uu}}E衬UUUD$4$t^@@t@t4$S؋u]}]@t&EUM} uE}؋]]t&$Ή4$&U8uuED$E]}1D$4$tRU<@tW<*tSE~QD$$щ…x=ET$L$$D$E D$ $袧]u}]Àz]u$1胧4$RאUWVSlEeE11}}EEUMEEEEf}߉}M܅\$vJMЅ;E!E_EU$EED$ EUċU)؉T$D$@6Ut&MED$ EU$M̋M)؉UȉD$L$跥@^E"U'fJ`A$}ԅE;E}{}}}IfMED$ EU$MM)؉UD$L$@u}u}9}yu؅n{5tMTt t t uTt t t t }v}Ѕvt}"t }`EEEt&}|{}'uЃESEJuȃ}Eu}/u}ĉu}}|(ECEED$<$H ]$Me3 Ul[^_]ÃE%Mԅm}uE.fuR lj}E|}E;D\uE.v'UWVS,E܉U8E؅U1ۉ$M؉E $EEE$ }EEEEU܋$!u~lM1EU؋$D8$诳U܋M $L$蜥U؋D$$耥;uuEU܋MM$dME9Mb]E܉$CUE,[^_]ËE܉$OEE,[^_]É$9Eύt&UWVS|EeU1ҍ}EEE$E%E؉$}EԋE4uEEM؉${u‹E؃$tML$EE؉D$E$茟E؋U$BM{E@tMe3 E|[^_]Ëu؍M؉ڋE$}upE؋Mt$D$ $H]EEEEE)EUԋMtx<\^;D\{"UEUԉD$ E]u$)UD$T$ݟ@$UԋUԋMuD$R  $Vt[ËE+]D$\$$o\UM\$T$ $W\E>t 8i4$ҟE$ǟE$輟U$豟M $$藰UT$$茢MPE$wU$謡$]ML$$RUBE͜EoE]u`E11EED\MЋU$Ey\$EEЉD$E$@[E$te4$<$E|U4$ÍDD$1Ʌۉ~M1ɍ&9uU<$^M $SޛvNE܋UЉD$ E]܋u$)UD$T$蝝@vtUЋE]Ѕt>EE]܉u݋U4$םM $̝EVËE$譝<$UUE$Ɖ‰"4$ED1E1ۉD$4$|ZEUED$$[Z9UOۍvDE9}4M]ȉME)؉1)Ѓ$]E1;]DEEL}$蠭U@MMEE9]]t$!讝MDPty1t&DPtE~E$T$MMQUUU̔Д]u5}=|UE$ |p ' Д̔uU]5u=|}ДU̔] UWVSL9ʉEȋEUĉMEu UȋEEL[^_]$ȫEE9EEUEUЋEȋMЍ M̉$МE؋EЃ9EEԉE~p}̅Ew}18t1vt8u u;M~EU9UMMU҉Mu E9EE9EKu+uF$Ϫt$ỦËE$D$3$$裙4$ۛM||$E܉$E܉t$$&4$nU܉$裛Mf{E؋]$UЋEȃ-$wD}]Љ4$gD8ED$U܉$}E܉t$$貞M܉ $7Uf,4$M9M4Et E܃L[^_]ËE܉$M܃}҃}TE܃L[^_]1vŰ]$ɚ$z\$$rÉ$t$^Mԋ}M!E9REUT$M܉ $蘨E{@E)MȋEL[^_]UWVS }<$$Et_$ŗރuE 1[^_]ÐU1}]dXH\/ Ít&U]H\dÍ&UMu f<&ttft <\uu]1ÃI1]ÍUSYZY؃[]U1҅tɉÉ'UEP\]UEYH\uÍt&;Y(ÍvU$`p]hÐt&U8}}]u5L\=ESL X4YE$C ɉ<$+ËE$D$̦|$UT$MËD$ J D$D$D$$Z1XMQ\$$T$_$ut4$[ v]u}]WD8\L|3\AE:/iEUWVS\tX\1EP0=Ѓ D$E4$D$諫áT\D8E U9X\~BT\@tYD$ D$&$D$Rp\uO} tEV[^_]ËE$[^_]ËU: 1[^_]oVVtaM:uL$$›uUV$W̉4$觓v$ו$舤\$$耖V} S4UvVt M:tUX\NL$$'uU1vU=M`~DtPu$utt< t1< t-<#t&t#MUt&D$ $Éʃtt< t< uv獴&'U=tÉ$0Ðt&UH}=duu]uDXt:t3,8tX -8u I8tE8t>Bu퍶EtH\t;u؋u]}]É$ED$4$vtCM uDljEttu E0돋]rx<tDžttED$D$D$ ț$Ǝ넋E$7 D$:Eu;E$}t t $u11VuE8t$E멐USthu1ۃt[]Í$0  tހ8tٍED$\$$6tjRRh9} xt7\$$脂áhl$1 h ؃t[]É$1áhlD$D$A$?u$输ht&U$1 H\d/  $1 fU]] uu~|[ts~|{tt|(t-]1u]À|$uݍDD$}$`uHÍDD$)$F]u]Ít&DD$]$q]u]Ðt&U$42 </  Í&'UStD$J $1 U $1  $1  $1 D$- $1  $0 u t8u t[]Ít&ED$\$$͋uۉ$譄hPsPlt[]Ð&Uxuu]hu1ҋ]Ћu]5P;h~ED$t$$Zt4t$h$¡hlh]u]謉8uD$D$A4$荊x $뚋$D$D$K $7\$t$$#UE u 1Ʌu]á t]Ít&U1]É'UWVS ]$蠎$Qۉtstlu ى9tXt$t\t%u߀'t"fuڃu [^_]Ã9u [^_]1멉΍t&UM<"t1<'tT$ $>ЉT$ $-Ít&'US t4~ 1ۍvP$a9[]Ðt&UWVSEEEU܋HEuC$0Eh\&UM]"u1E"UMUރt-$U܅uڡh\ދUuӋM]h\u*tU\$@uM $1}]Ct]ʋM JuډU]E$[^_]Ë$ӉC$EUB5h\u ]$蜉몋U$草M뒋U$uM]AE $Yoh\a$U܅QM$)]6&U2 E1É'U6 E1É'UVS=#`D$E$8D$p É$FQ$萈tt4$[^]ÐUStD$E$=$ÍED$\$!t$5t1[]É$%E%=@t[]Ð&UWVSt< < օt{<"EMt }E07t9\t9Et60ۍ >QttQ1ۃuUt9EuH[^_]<"t<'Euy:CY< t< Jt&D$D$K $QU|$T$$*D$D$K $|$$PU8]uu}Ko}1ҹ<$E܉tD$E4$D$BE<:„u>tXD$D$K ${t$$[]u}]Ät A<:ƒtu1ɉS<$xXD$E4$D$5B$T$ D$ED$褋ED$9 D$E$ 1mv`,UVSPn,911<u;\u⡸TE t]$4$5$t$$އD$D$K $r$ʽũP1[^]D$D$HK $߄$.莩P[^]ËE tTP[^]ÍUWVS }<$pp\ƅu < t3C9~~) 9:uމL$$u΃ [^_]f [^_]ÍvUuu]}>$>~d\u'Eu>4$赋1ۉ؋u]}]À>@uD$l 4$Ltԡ#D$@^ 4$K^x@v3tt:uT$4$n4$A4^$O;L8~A$T1v}'t ~(D$@k 4$0KÅD$w 4$Kp= $1TE 9E>6 nD$/4$KGD$@ 4$JN(t& 6 $D$ph 4$aJ,$2x$9f3>~a4$K9'UWVS<D$@eU1҉$,D$$D$1Ɉtŀ    ty#tL ø މ׉S C )    t t t t u(Ɉ8<$踁Ee3<<[^_]0< =  „B:  „&ɉV#MBt< t< t< t< vu9[+\$D$ D$<$T|Ƅ9 P! t€҃)A$蔏|$$茁P< Q< I< A< 9Fu"H)ЍK )P L$$PwvU$1 tEPt$L uٸ8L ҍUuPÐt&Ut)$))$ }1Ít&U0B |pr PB Ít&'U$l\Άt\t E: W1ÍvUWVS<} PB    "+'EEE8`KEЅ1u5<[^_]áD$e<|$$71\t~;ut${1v<t!XD$CL \$$ 9}ًD$CL E$D$ E< < ]D$JL U $T$D$ED$$m79]؉EEM܅t E܉$zEt t D$P2 U$NCƋEu ~ vEЉD$UԉT$ E|$D$U$<[Ɖ^_]ÍLu t t"fK҃Ut!T   ˅;Et&u1ۅD$ph E$`BD$$CL WL<&|{\$$MxF<`u;U1E:`^D$e<U$T$ EET˃  t tE<>OuD$e<U$T$$f7]EP t D$$3;ED$U؉\$T$ ED$U܉$h&'UWVS];c<"<'E}EE8~]}i}11};]t$w}<$yD$SEutX f\F;t>t4<\tD$$Zt\u<$v}<$yƍ@$ˇ|$É$y} ts<$v[^_]Ã} }]$ED$ $EE;"}tD3뀉$XELdECED$!$9E$EEE$v ED$$5+&'UWVS,MuT$$EE 4$}w$.|$t$D$ UL D$D$É${U踱$D$D$ËE죴ED@$賙,[^_]$7$'$:h64$v$\t$$TwU҉øJ[L @t&UEU EK ]t& $UEɋU tEbL 1]nEK 1]_ U]|u5$|M|]5u]Ív'Uw ]륐t&U?]名t&U*]Րt&U@^ ]rfU?]名t&U@k ]RfU?]名t&Ul ]2fU?]名t&U@ ]fU?]名t&U]|u5}=pU$|p pkL LU|]5u=p}]Í&'U?]bfU=L ]u5||0u t($ ,L5|u]]Í$?LfUS=ku Д$PM Дx j-Д[]É'Uuu }}]@;D}@< t2< t.D< t< tD$E$@@~ND$B$E@@\$D$$E-t$xts$p*tz=\tu ]Eu}]ND$\<$É4$D$D$؋u]}]Ít&$BpD$*<$뭉}]E =u}]'U$O +&U$0O +&U$PO +&U$pO n+&U$O N+x&U5$ɚ$ D$8v$oғ荺1É'USE $D$13t6;|)\P 1[]Í&9}ˍC\Ǎv'U\xD$)Љ$+\1ÐUD$]Éu5t}tD$$5t9Ét]u}]É$8p$~|$$pΉ'USÃ$D$uDD$ D$D$@$0@$D$<D@$ED$ D$D$$[]Ít&'Uu5D}=@]$l9tB;=D}+=@8< t< tD$$ ]u}]fD@t&UStD$tD$ D$$8 hpD$D$$t;t t$!l$ D$ s[]&'U]ut)$|$kt]1u]]u]Í&U0t g1ÍvÍt&U$t 41ɐÍvUE ]@u5DD$E$vu u)@D$ $!1ҋ]Ћu]Ð)ދD)ˍt&UWVS ud\Ed\qL ;D$@$|h‰ׅu\$lD0$1{Ét<@u$iE [^_]Ëd\::It=N $k$z\$$lE [^_]ÃSN $ko&@D$C$8l3 US$t$[]$B ^tL D$D$pq $yL Лț/}D$D$S $L }D$D$S $L |D$D$S $L |D$D$ S $L |D$D$+ $L |D$D$P $L |D$D$O $L k|D$D$J $ M O|D$D$P# $"M 3|D$D$pO $7M |D$D$L $IM {D$D$O $gM {D$D$0L $yM {D$D$PO $M {D$D$L $M {D$D$0O $M o{D$D$K $M S{D$D$O $M 7{D$D$K $N {D$D$PM $%N zD$D$K $8N zD$D$K $IN zD$D$L $^N zD$@t]D$pq $oD$@tD$S $^oD$ lD$P $goD$`|D$O $KoE ED$D$@t$L=0y E D$D$@t$L=0y GD$$5LD$@tD$P# ${nD$@tD$pO $/nD$`|D$L $/nE~ED$D$@t$AL=' D$`|D$0L $~BnD$@tD$PO $@&nD$`|D$L $@ nD$@tD$0O $$mD$`|D$K $$mD$@tD$O $!mD$`|D$K $!mD$@tD$PM $g~mD$`|D$K $*bmD$`|D$K $gFmE ED$D$@t$J.=Pt #D$`|D$J $B pr PB lD$D$K $vlD$D$] $@lD$D$M $\uID$D$M $*YID$D$M $==Id\wN $zN Д G 2 -$[]96t&D$@tD$L $ HD$@tD$O $jTD$@t$ HD$@t$ H`U` UuD$D$$ FHÍt&D$N $N ]0v ǐt&US]t$a$c$rr\$$jdA 1[]Ðt&US$E_EEE$nt8u$1[]É$Gc$q\$$c$$1[]ÍUWVS~u4$D$ 4$"Wހ>.tc(t$ W4D$4$D$4$(V$ 1~P1ҋ9u05LHLu 1ۃ[^_]áHt$S$IbáDHLD$@$"T؃H[^_]ËE$FSE衤111EE$PM:9=~4EuՋE;E~vPU9=ŰEM{1@@WfUEMЃ))M4$L$&YET$ $D$V. UWVSM ]uVt$O$Q$`\$$R$Q${MvQãEU::t^C0t fst:uEt$D$U$Uu։4$2Q$_u E[^_]QUD$T$E$Uu$P$_] E[^_]QK1[^_]ÐUVSu ]uNt$aN$P$J_\$$BQ$uP{P&QãtS5t# :u׉t$T$ $TuË$P$^] E[^]P V1[^] U]u}7$%|$oMD=@E~4$JM$|O$-^\$$%PD$É$ۉt$M4$4$G=$L;}tW;=D}K=@8< t8< t4D$$1 ]u}]Ðt&1D@1$b]q&UWVS|E0D$$4$肵zED$t$$7L`4$D$芿4$KEEuk?.tt$N <$ÉD$j $KD$4$萂4$M|/<$KE4$rKE|[^_]Ívu4$t&M$@\t$$8ND$lj$R$ ‹EE:4$J<$J$?;U:t&4$JEE|[^_]ÍD$`4$4$LD$e<4$D$|iE$LE$D$ZU/DT$4$0RE%<$J4$J$[UE~UWVSEEE d Uv$tft` w$vt/9~ʍB $D$C뭉<$IUBUnD$ ` D$D$$ FE裐$ K5=UtUtIXET$<$D$fOuԋ\$J$gY] E[^_]YK1[^_]á$^ q4UU }}]u<t$G;t t$Gt$GD$<$.ơ4$I$lXt$$dJ4$IÍ@$FXt$$9J*D9t4$G$T18=ƒ!‰<<1t8]u}8]Í&4$H$Wt$$IkfU]]uu}} tt ;u:t]]} }uu]TT$4$%E${NE$DBE9}%E]D$$BU]$?9}t$U$,PE]E,[^_]ÐUWVS ]} t<1$&<\t < tBt<"u܃uQ$9P"ƍHu!L"tc\t^t8St- u\AnA"A A"t΃u"A [^_]Ã_v\$OƍH"fUt8tËE$t&۹t8ut8uءÍ'U(]]u}t;u%]1u]u}]ËEf$1 dtUtNCtCPt8ue]E $N}|$Ɖ$@Uu/녀xuE $N\$Ɖ$@MXU EKD$\$$=9ÉEt}<$?Í@$DN|$Ɖ$:@EEN Ɖ Zt&UWVS,u ])C$MuE19u~"1҉ً]:29ʉEuUt:uP|$D$53$:Et'EU,[^_]À?uwut ],[^_]EEN D$<$ËEtxp\$t$UD$O $T$ D$9$;kED$]<$\$<$;E߅lEU,[^_]þ:끍UVS^~G<1ۉt& ^ 9^~"Xuu$^9^ރ[^]Ð\$$JL 耤t΋^߉^롍U8D$$=1҅$1 .$D$=$1 $D$f=$1 $D$J=$1 $D$.=$1 $D$=ɉ{::0t&US] t$ :tI$=<$J\$$<t8u[]t&1[]$JfUSU] :Tt>B:zEt 8$1 1$D$9D$$6xD$1$9W$G7t 8o$1 1!$D$u9&U$1 $1 D$$1 ұ$1 D$BUSD$:$ 9ãt$$v8$'G\$$9D$N $ f5$ *<[]US$1 =E$1 )a$1 }$1 $1 $2 ٰt8ua$#2 °tI8tDt$J5$7$3F\$$+8ңt:uC[]át$5$87$E\$$7evD$$(4[]á,8#D$$\7v8D$$.78D$$6tt&v8mD$$6Xt&Z8QD$$6T$Ft&u#뷡$,$,1}t&'UVSÃD$$ tPt:fu&$.$k=\$$c/[^]Ã[^]'U@E]fU$E]o U(D$]}}u$ :tW@EtH<$=u\t{S$Åt}t5X؋u]}]É<$tCE11<$t<$-$Z<|$$R.뮉<$늉<$t$u t$n<$$*tt&D$ \$<$D$32&'UE$ɃÐUp]pÍ&'UEWV1StI¿-J 6 u@"t1ƅtz Zvʋ1ƅu[^_]ÐUVSE$ $tHD$$/É$$1%tu 4$eÉ4$ [^]UD$D$ $lHlÐt&UWVSUD$ D$$/'D$D$4$/ED$D$ <$HÉ$5=EuX|$D$$`lHlED$D$<$/1[^_]Ív|$D$4$ lHlE ~%} t=|$D$4$Mw1l[^_]D$D$0O $A($Pt&'UWVS eE1BZR ߉@t v/t&t$(P v$8-tI<$<$'Ue3 e[^_]Ðt&xuD$D$ $RƉ<$&~ ~FV ^FB4$r1_ED$<$ot]uډ11 9 VD$D$$0sED$D$$O fj "7 M G4$'t$$ÉD$#9u$))E$'E$%~;r>$($T$% D$D$$*tg t $14(,1ۉ$1($C# $tu _؃ G<$ơ$t u_$tBQ D 7* zD$D$\4$tU HD$|$4$p 4$"D?9(D$D$$)$&$T$#X Kt'~D$D$$x(9t'T G$% cYD$$"0t&|b<$D$ $D$t3|D$D$$VD$D$$0D$D$$a |$|$D$F$F$")čT$F$D$n#D$4$ $-"D$G&$ C04$6"; t$ T$&D$|$4$D$ #$z'u $$0!ED$D$$$E#E$!E$'%9D$D$$S%e$"4$T$4$T$ t'~D$D$$$94$1A4$7v,D$D$$v$ "$D$]@ED$t$$E%=D$|$4$ |$\$$#u@0%=t.E%=tU|$ T$t$4$$!{4$D$!9(E$&E$$ D$D$$"4$C D$4$ZX8DžtDžD$|$$J9t<$;4mc$v$9D$D$$!1Dž<4$$:4$RK $D$gπD$|$4$&w4$f0u$  $ E$6 ]}8 D$|$4$WË D$D$SL $&Dž8v4$w$r&R<$ZU(]]}} us8 f{ CO Ex$T$<Eƃ<$t&t$$D$'EE]u}E]t&K |c$tqt&C$%E$t =uBC08&7D$D$O D$D$|O $$t$$DE]u}]Ã{ wFK t5CD$D$O $Ev4$D$:ƉEft&D$D$XO O$D$D$O $T\$$tHCpSr BUWVS } ]t)lt$lpt1u!ttt$$' [^_]ÐUE]Ðt&US]$S[]UWVS U}tV1ۃUu$[ۉ~F1ҋU9u؉F1 w [^_]$H[Ƌ11Ѝ&'UWVS |i$[E|i~dE11xi|i0tBu B9UEz P 1[^_]ËU112 UWVS |i$zZ5|iE~XE11xitBt B9uUEz P 1[^_]ËU11Սv'UWVS |i$YE|i~^E11xi5|it B9UEz P 1[^_]ËU11Րt&UWVSE҅0E&EU uЉ߃$#YEEEM]04$$I$t$$AE]9]uM]YEH[^_]ËE@[^_]$X1EE봋U묍U"E1É'U!E1É'U!E1É'U!EÍUWVS,҉E؉UEY$WEܡYEUE4EE9ELt}PtM9H uЋZ$$"\$$QL ҉t_RL E SL ɈMuxt69t!Mt9t9utt&U܃EBы<AE9E/M1U؉J,[^_]À=TL t҉U9Ut]9tM#t&t9Uo9g9u^}t&hEvY‰D$<$,D$QL <${fUE] U1҉E]fUE] U$]uuU Z$ Z[^C1]u]ÍUWVSEE$q[E$3UU:Er11҃}~mE1EE01΃urt,4$$1 t$$)u u;]|ExE[^_]E[^_]tTM<$ $|$$uF@막'U$]uuTN$4Z^C1 ]u] U$]uuS~$Y^C1 ]u] U$]uuuSn1҅t $Y‰S1S0^]u]Ít&U]uu}ٳ$S8@<$8Y^C1 ]u}]USÃ$lP [x$vP Ox$P Cx$P 7xt `W[]ÍvUWVS,} eU1҉MD$D$$lP 苂ÅtubET$D$ D$4$/$vP D$螃ttHt.`WEe3,[^_]ÃH똍$P ctwPu\@t^UD$$T$[`ED$ED$ $T$a.$P D$hP뜉${a$P }wxwvUWVS $D$$EF$mD$$ËE<$>D$$~ljE~D;Et/ u$:D$$6E [^_]ËAtЉ$ڨ$:Z$:D$$UÉ<$D$$ljqvUuu ]]u:t$] t8=#`$D$ңu ]uE]w$S $\$$ UWVS,u8.~#] t5U uA<&t&tt <\uuU UEU8!EUF$NNɉEEE ftW$2 EE9F~]=]UЃ D$$D$}ttUtWEEW9FWU 9Ut E$,[^_]ËED$ D$&D$E $EU EUUt&'Uuu]^t0t%t0$,&F]u]Ít&$Suѐ$čt&UWVSÃ,t@HCE@$GM[4$]E{Et 8EE1E@~{1!UM:]9{~PEu؋MuU21t$c $\$$ ]E9{UM]YEt E$E,[^_]Ex2Ex!$E$8$7EL$$D$C uU2 &UWVSxUeE@t&J~ f:@t&fk)vt& t&Pt& t&t&Z@t&t&t&uS tCET$|Ɖ$ÉD$E$M4$EP$IE[^_]ËED$@o $HƉ$ÉD$E$=M4$EP$Igt&ED$p $Ɖ$ÉD$E$L4$EGP$OIED$@ $Ɖ$=ÉD$E$L4$EP$ It&ED$ $mƉ$ÉD$E$bL4$EO$H`ED$@^ $'Ɖ$ÉD$E$L4$EqO$yH t&UX^CD$E$K$E?HU0^ D$E$K$E Hzt&U^OD$E$jK$EG0U^ D$E$4K$EGt&U]cD$E$J$E_GU]-~D$E$J$E)G_t&U츸]8D$E$J$EFU츤]D$E$TJ$EFt&U|]D$E$J$EFUh]MkD$E$I$EIFLt&U@]%D$E$I$EFU,]D$E$tI$EEt&U]D$E$:I$EEU\mYD$E$I$EiE:t&U\3D$E$H$E/EU츴\D$E$H$EDt&\D$$\H$EDnUWVSUE)|E@ tm$DUD$ËB $=t$JCC|\$ $G$|&DEXt ;MY E]D$\$$ UD$JL )Ӊ\$EEMD$ED$@+E $D$ v]sE}@4$eTEGM+]$ED$ڍ])MU<$i$8Et$$L$74$P1$P Tt0@tp`t F F$P hMA ]@ME+U$D$yUMB U$MEA $XNjE]uu!:xt xօtCt8uӋօuF$^ UEB MD$ $E U:uDEEt$$xUtME M4$?tQGtA$R$MxD9|@9}E\$$ Ew:븋UM $D$_@]$EqE$ EtU:.$UB Et ]$!}t E$UB$tU|MD$$L$|t*9|t"|t$h| $Z|]SM|AT$$D$D||tS|@tFMA@ul|Ĝ[^_]ËQEEMAUBtuU@ d$|OU@ >ƉD$|$*C4$|?$tOKt&$wP$g$D$D$D$ D$D$Gr$$E:U$$d?M $EmE8ExE1EtluFU:6tH}u]F};1t$$3 \$$+6EuUM]YE$Xut U$M|L$$A|E$=$O>u1҉։tp< t<\ut< uT$U\$$մWEB9GGM G> tZڋuuW]$||$$@<$|&=UB  UB< t둋E| *BD$<$>PD$D$P $t$$ք!t&E$Mv|MT$$L$}U:$<4$:;F CC$P b|\$$?$|<%E1Ex $EU(]]}}u$t_$t@E\$4$D$ED$ E D$4$^tJ3$4]u}]ÐD$/$Tt$zu t&11fUWVS2"E‹1BuUG$7;EE1t&MU1t$$$\\$$TMM9uEEUxxB[^_]ËE@1[^_]$1:EM1믋ME륋1UtB]ÍUUtt HuvÉT$$ɐ Uu1D$D$E$t@Í'U$(.@@@ @@@@@ @$Í&US]u{C t$Ct$Ct$Ct$Ct$C t$uC$t$f][]Yt&[]Ív'U]W&UStFED$T$$1t'Ct$C$$[]Í&'Ut$)Í'UtD$ $! Ut$ ÍUuu }}]tsD$<$D$nË@t$s]u}]É<$$|$$CD$D$P $|$$`fat&'UWVS }$(H_ ƋGFGF1t$i$\$$_F 1t$>$\$$_F1t$$\$$_F1t$$\$$_F1t$$n\$$f_ F1t$$C\$$;_$F 1t$g$\$$F$ [^_]ÐUEt]]Í&'Uu$Y$A+Ðt&UE}} ]ut'|$$/ƅt%]u}]Í<$ƅufkD$D$P $ãl\$|$$ؘ롍U}}u]<$Zt]u}]ÐD$D$(Q $ã\$|$$h붐UV1S]D$$tat[^]Ådu9t$t0C$1uߋC$%V1t&1렐t&U(]Ӊu}Nj@$"DtD$$t$ D$%$D$4$؛$8]u}]Í&U(u5$]]}1YD$ $yt&pt]u}]ÚdE}EzU1tEEEUBt(<=t$1҃<=tuҍ<tɍvtv$u$Z$E럋 t=t2t&YCu<$;}?11}D$$蕜u1D$D$$9\$$EGD$$AUWVS<}$(11D$$1؛bEEEED$5<$ft;P(w $f$(<[^_]ˁa =dE;t&tE܅tE܉$,]ۍvM $$ED$1D$$JU$T$D$UtNML]T$ D$D$$uMYt $R {E$51t/Mt(U$$1ۉD$S@t/Ut(t&D$D$E$dtt&G$?uE؅E؉$r΀u`Ee]` OG`U6`@E& `M`UE$AE+Uԉ$E!$fa$C$&$ $|$kM $`x3$/D$D$c$U܉\$T$$U(D$D$$CUT$$ D$D$I$\$$M$wL$LD$D$w$UT$$D$D$$M$L$D$&Uu $tD$D$$($ Ðt&U]]u1҅u ]Ћu]D$$щƒ~/Ɖ9|~أ]1ҋu]9vf|wD$C$zU]]u1҅u ]Ћu]D$$zщƒ~/Ɖ9|~أ]1ҋu]9vf|wD$C$zUE]u$iuC5df1҅t6F$t]uE]$2]Ћu]ÐUH$M ]u}:t @g1$V :t @C1$b :@XC CF FE$udEG GU܍ED$B$MUE$T$D$OU4$E؋ET$D$0U<$ËET$D$U؅t/t+t'D$ E؉\$D$$D$1]Ћu}]ËpxU܋B$Hʼn$D$D$D$D$4$jt't*D$ \$D$$ 1hһϐUSÃt$$[]Í&'U]Åۉu5`WthD$D$$' @Wu<`Wt2@t,t?\$D$$PF`W]u]Í:둻:fUV1S]D$$4t@LtPt%t&[ [^]뽐뫋 ؅$uvۺt$j $t t;t$U؛$؛$ 1҅W؛$;D$ D$D$$T 豠bQ Q$D$Xá( $Q  Uu5]}`W$' ZD$$' ljD$Tu `Wu1yt;5t4$]1u}]Í@tʉ|$D$$C`W릍4$D$PN$Q ;UWVSED$E$!D$$ƋE$Et>4$6޻$tbE$su]Q  4$[^_]D$$nvu$tub8ËE$to;1ۉ4$[^_]É$1vBt'$trt4$1B[^_]Ít&4$ 2Q )tG$ u$j$]}t&놉4$-t&'U8}=$]]ut$$ ]u}]Í=uD$$t+LtPt뱍t&1ǿ5dtu tf ЅۉEC8-u x~$ CE؋E؉tE1Ev|EtUE؉$D@$hD$ËE؉$+wtt $-돉$3$$D$E؉D$I|$SVE CEE@D$$E׋E؉D$$4$ED$E܉$u$E܀8$5$' UEE|D$D$$t$XE؉$cUoR`E؉$-$ )UEED$D$vf}tut$w4$U1]É'U]ÐUWV1S]=ED$$VtCpt"vt'Vt&t%y[^_]E뻐볾t&먋=d1ۅt΅tUEEt$G$迣}tuG$f?]u1ۃ}uUt$t|$x  O$GBËp<$wK0FC@ C0\$$@$P$$$ %St!$$\$$É\$$` ~D$D$$tI@$aƉ\$D$$\D$t$$ L4$,$/bin@:/us@r/bi@ n:/u@sr/s@bin:@/sbif@nuD$D$:$ Lv'US]t%\$D$$ JL][]E []AU ]ÍU] ÐUt ]Á=s t ]à ]Í'U1ɉVSu1f1B<w\Ё~[^]Åtu[^]Ív'U|iD$ D$D$xi$fUSEE )‰t[]ÍvM ][]WvUWVS=|ixdxiUEEUf~P{9} E<$:EȋEȅuE<$6aEEȅEȋ@Et!Et<$E<$6UȅB@~MԅEEEEEt EEԅuEt EEȋP UPE!ЋUȄۉBE؅MЋẺ$L$D$<Et E@<$J<$vPt EE ‹ES!ЉC<$6U 1}<$lE<$D61 6ML$F$ |tދF$̄zE<$6g<$y:ED$D$, $ |$$9U1tM̀9t yt y6Ù:(EEE1E܅]ą~U[MD$<$L$EȋEM^E[$FE=EEe$s؛$F15EЋŰMȉD$T$ $z/yMȉ $ E$D$D$|<$EdE E<$)EED$D$$C$'<$$trMȋY$$\$$ËUD$\$$?3MȋQH PɉP~ P$YEȁH mUD$$T$y<$bf'fkt$>Cu4$DD$C<$D$ EE|)CTUЋMD$D$T$L$ <$$ttp@D$BD$ D$$D$J $}$(D$D$:<$1E8$k UEt ɺfD$D$$$Ðt&U1҉E]UWVS<$$҉EtEEUB8?-EGEE_t^u\>tÉD$$uڋEt'u#‰EenE؛$菽}uEEUB,;#{ED$ED$ D$T$$ƅtD]܅M~*v؛$T$ EEۉ4$EU҉EuXt8؛$ D$&UB0E؛$茼E؅t؛$ D$؛$3؛$F1҅t'؛$><[^_]1t$D$7 $04EQ„҉E8U҉UFB8t ?-؛$7E뮀{c$TEEv뵐UWVS1ۃLuD$4$tLaw$L[^_]Ãà 뾃빃v뱡`E뤃럋=$dUut u ؃ t |i~Z11ۉxiPt9Pu1tt$t t f95|i1]$؃ EtEUD$$8UEԋ}1u$EEE6ECBCBC B CBCBU҉UUB8<$ظÍ@$|$Ɖ$}_str@uctEԉt$$ζtQ4$PCECtCEԉCD$<$=UЋẺUOD$D$p$4Uȉ\$ t$T$$ 4$ŵD$$D$観D$ $D$至1UBD$E؉$EUBE5|i@E~.xi11ɍvE9B9u]+xiiëEčv$MEɉU xi|i+UăM$RT$L$˶xi=bt$致-|i5xiEE$\ D$D$$荴U؉T$$j뭋E EuЅDU1$뗋U܉$薲5|ixi]\$4$D$1,`$,]X$]LEE=UD$B$$t&u$t@tH$UB$E뗋E؉$8U̿$Eԉ$謱D$D$4$4U؉\$T$$ u5|iv$ǡ|i<$@D$xiD$迴]Ѕ~@|i1ۍ@ NjE̋BABAB A BABA;]u͍v@@xi=bt$=xi5|iUD$D$L$,Uȉ\$T$$ZUE$u.df1҅t"$D$D$ $*ɉÐUWVS\$M t @Dž$V t @Dž$b t @Dž$/ t @Dž$/ t @MDžD$$ED$|$$諶NDžhE%=@y =u]u S9D$D$$;T$$t]\[^_]Ë$讯$Z>u1ۃ8t\[^_]Ë@@}@K@f@f8eflDžP $\$D$<$a,0É<$谲3@$yD$$%D$$ D$$(D$(D$$ 腡T$$D$ÉD$$$购D$S D$$%s D$$ o; @ltE--(D$D$ $gD$D$$$D$D$$$$M d@tzP9D$D$$ (g E1녋T$D$$1ۉ$ӫP~PD$$\ ~$臫$ D$D$D$$+$sD$D$$$MD$T$$EE1ED$D$$C$rfD$$gD$$(ScD$D$vD$D$$A$$μD$D$s &'US$} 0ҁt uEng؃[] UE]? UE]uD$$!_} ҃ 4$h؋u]]ÐUWVS,]$HD$$,D$$ޯD$$ ʯD$$趯D$$袯YD$$H\耯D$$@H~Et ',4$2u- t ЃE EuED$E$8SED$$t?EuGGD$ t$D$$<&Mnu EEO$ t$1f|$$6E$@D$#=E|$D$ D$D$$EE$<$菝$1c8t&$tt ,_EE,[^_]ÃEt $1,E룍vEt $1 E=,8E8EP ExE@@E@@ E@@ E@@ x zE@X { $tuC$:{E$t u-UED$$蓢ErED$D$E܉$ ËE$E܉$E$@ gD$$dg$D$eD$$,E$ D$4PE_ 8E8EX E@H ExE@EH@E@@4$BE$NE$萣D$$2s&U t$֍!s$ÐU$]u^$-Í@t$$؋u]] UW1VS]ݫEED$N$tKct%lft.at0[^_]Ðt&E븍&몡`E렋5d1ۡl$Jlt$t$u딉4$D$ D$D$CƋ$gZAU]$E$`tU;t E$]Mj$訡zEdU1ۅt vE\$t$$*EGU$tv蛝$D$D$S$SU\$~T$$'E1t U$נu=u$ u$n$tEt 4$t&膌$ju YNE$K]Ë$-U$[$ UT$$d$#袕f~$t&#<İ6$f,Ut00táuD$$jÍ'UVS tC! t5 t-@ t%Y~L1ҋ ty t19u= tv4$A$_D$D$y$D$D$ț$.! ! [^]Åu눍&'UEt &D$D$$h$LÐt&US]t5 t2D$țD$$iț$l[]lǐUWVSӃ31҉Et  u+`4EtlE8E<-tp0< v|U$腟ExEt7v t.8uUD$T$E$uу[^_]þ[^_]ÃtE0< wD$ D$ D$$ěE|t+(9~똍t!뉐&UW1V1S\]{EEXEXdt#@1:-D$‰$CYutD$$Ot_ew f$Xt\[^_]Ë=`덾EzEvkEt&[dEt ?-xuE&p$ ^UB$芝$;\$$3G4$h$t$$]܅ۉGtE܉U}܋҉UUD$=B$[M܅[]ËUBqb$ќ$肫\$$zE3]܅E؉$虜$JU؉T$$?]܉D$ CD$C4$D$$U4$uЋE؉$]܍C3t$Ct$ԙ$ʙuҡț|$ D$D$$EEt}؋U؀:UD$D$$vE܋t $TSE,\}1D$D$$p$Tu܅t1]܋C3t$Ct$$uһf[ t1t&uƋE+5`UBڋUE̋@ڋEЋEȅu `EuЅ.&E9E~UEẺUЋMȅO؛EԋUЉUUąuẺEEąE9EE~E4Eȅt@$fU4xD$D$*D$ Eԉ$ UԋD$D$$D$ EąEăm@U9U;yD$D$$B$D$NEȉủuЅmUO1uhE{$U؍D8 JE؉$oẺEЋEȅE멋UءțD$D$T$ $EU(D$2 D$D$ $贓U&:$讧XE1#1uED$D$$hEE$k]ۉD$D$$貕t$\$$Eg$?ZU$ T$E4Eȅ9Eԉ$趖<$6ËE$)D$٥|$ËED$D$ D$D$$pD$D$$Dt5E$E::1Ef$MH\UE$ D$"E$D$D$$ ۚE $6$M訙=$u4E$$蹤t$ËED$:#U]tuƉ}׉$$D$谘$\$D$$ؗ4$;Y|JtF$4D$D$$腗؋u]}]fLt@tvtO$|$>xMD$D$$.u1f]&g5Y@Y롅O5YDD$D$$耒ST$$]&UVSYtIE$u,df1 tt1҉=u۾u[^]$evUYEt>$腾u> dt‹uB8&t"ɺ$ɉ1ҀxUUBD$ BD$$D$1 UUBD$ BD$$D$跎1 U8u5X]]}u8D$D$$跐$蛽؋u]}]W1EEEED$$YtPdv臼f$ EE&뵡`E뫿E뛋5d]܅t$$89>E/tFD$$D$[$C6tAF$jEtF\$D$$D$ 1ۃ}M$Eۅt2}t,ED$/$tE$ Z1ۅ1AE$_tk$k$D$ED$谻6F}8u<$FuߋEt<<$gt̉<$뽋ED$ D$<$D$nh뜉<$fu<$趹u<$aE.$c<$E$Bf؛$WCF$qE6u/t0Xt)M- tiT$1ۉ$wjMg$1ۅD$D$$k\$1$D$$0. |D$ <$D$ED$!gE$躌A<$UWVSl]eE1蔕ED$8 $譕t.sEt׸Ue3Wl[^_]Ëd҉UUB$9E5xiEUBE$5ۉE1EEU\$D$$菒t*=\$Ѓ D$E$膢yxiD\$D$d$D$ \Mum5xi|7 Ft[8/D$D$$jD$ 7 D$D$$D$Cu5xiE}E>U҉UED$D$ $UT$ T$$T$躷W5D$$ɇdD$$D$D$05xiC;U$ɛ65xi &؛$臊1zE)D$D$ $$D$藇ED$$\$h^$D$D$$蛉$D$;5|iE11E$ U95|ixiBD$" E̋BU͉$D$EED$D$7 $蔆Md! t€u҉˃+]"8؛$ D$5#u&;1$ət~$ 71誌O$资7D$D$l$t$\$$5xiD$D$ 1(U$Kt$vMɸ USJt_t1 uX($Jt0I9؃[]É$I؃[]1ۃ[]Ðt&UX]1ۉuu}跏D$i 4$׏t`aw $ v]u}]Ã뻃붃뱃t&맃 뢃띡`ˀE됃@닉؋=dv8t3t.D$D$ $K$/t@5tw: pu2`u~tL\t `<$1D$É$lp$n pu `1B؛D$E$z؛$ D$Et$?ED$G$jyGD$D$s $\$$Kt&1vK@lOEEt!D$<$ֽE؉U܋E܅!Gt>11t uЋM܅9M| 9U+}؍$1 5Eԋ.tsEԅt EԀ8:xL$vT$*D$ (D$ $D$]t$rOu؛$у$^LEE$D$$@D$ EԉD$ @=@*: G8O\h1l5(EElD$<$D$vDD£lxu(h+E)Уhf@??B,ED$EЉ$?t]=(MU9H|9wB9|/9w+)DMD9D$D$ $ŁD$EЉ$ҳ11p<$<$vs<$w]؃U]$0 YF$CFUWV1S<]ډDžDžD$0 $tTht.rt7at&t5 Dž<[^_]DžfDž뗋=ddDžvvL;Y $=MD$D$$sH?>h$C|hD$$$|D$hD$$t/ED$G$s4$yD$4$脂$y\$t$$踁<$tL]G$vtj6t`F8%u4$谬x;Y}ڡL҉tȋF$|^B$T$覟$; vq?Ëp<$K FC@ C \$$@$腷$Km$; 蟁tZtf1$臍D$D$H ${$٨f1$tQ1$菍Mu [^]  [^]ÍuȐU }}]Éuօt 1ɉ uu?ЉUEEUU11 u!t1]u}]1y;u|;]vwɉtϋE)ȐUWVS E~W}11ۃ0$5EUT$$v=95E~t̡$75t&$ $øT t$59Ét-$t$DUT$$ = [Ɖ^_]É$DUT$$<$t [^_]ÍvU]]uu M}}؉$E‰ t x ;~]u}]Ív$-t<$ev$|$$wUS$U<-t*<+t!ED$$0u1$[]ÍڋUMEE $‹Eu$' $[]Åx;t 럅u͐t&Uu$ 芠D$ $訥ÍUWVS,uEEE:O+xED$<$0F1ɋU]8+E$L Ë6t6F-uxux@D$$6$2>\$$6É$ܑ$^[^]É'USt t؃[]$؃[]É'UWVS<]EE+1E.+uMHED$ $+C8t$C0-uÀxučH@juUxH$`! H$ke(Dž, ( t L< 8<~ D$$8=j< 8< tn5؅s LPhHhQ@hA0v BBc D$$@W hE$ D$h<zDž0111DžpDžDžDžDž Dž$Dž`~:EG9$} 1EU<~9<Dž8t$t2`*ț`D$$]ț$Jb0ED$HD$$蛅 hDž$E<\%:<t< E胅EL$$bqEgE$ D$fHED$$- M4$pX$ơf4$b4$Í@D$pD4ֻ4E胅Dž (4DžDž$ :$ :``ț1ۋE8 L<8z<~ 8= t $'0M-$ \d\lm\ $\D$$@$TED$T$$誮t2U$΍D$\$4$ $NE$'nDž@DžXDž8:(@PD$$ c(SxD$H$D$cE%=D$$ceD$h $#nD$$W b87L$R_BHD$ D$D$ $d*YDž,8$b ‰EKE؉D$$tU܋E؅x҉L DžLhuM苅TPʀ8u #t&< t< t< u uU苕h2AED$TD$E$~dEdƋd $[<$蟭hfhhA8<$}tE8S:랉<$Uu؉<$9P$kDžl{d$>ɉS$j71҉;5\$֑E$jDžlH$^~t&?= @E$ D$=`= y,Dž0k\DžT:#f`D$D$P $Z\$$Džl-`D$D$t DžL= L@uU$$69}t}$&苽tt E8t $Bf6m$AEzD$[$PEEU$눉$6EMOtmU$T$kbE?1}E)D$D$$Q$~D$D$ $uQ\$$U~6E^D$D${ ˉ$0t&'UWVS<ieE1Ұ111ir$ЅuitHiD.t$tՋtϋi$RiD.ҍ|8uG$-aEСi11fitC|.tD$EЃ$Ri$RUЍ:xiuGUл$ jt@BÃED$$ D$(PۉPt uYUЉ$IOEe3uN<[^_]Ðii$QQD.|8o1FtPSUWVSEE졀itvU111U&itKU:uD$E$Vuҋiuit(UU[^_]$vu[^_]Ëiv'UWVS it`U 11:fitB:uD$E $Uu׋iu8itUU T$U$1U $ [^_]ËU$T$1҃uE $΋i1}-1븍UWVS}uE\$$-$4Mt$<$uփ[^_]ÍUSEt []$ 輣tPfyރuًX$O$]\$$Ot$K$L럐US$轙i1t1ɉiu؃[]Ð&USÃu+tT\$D$ D$ $"J[]Ã-\$ D$D$ $I[]á몍t&UWVSiu} tw1-vit}$ЉƒUt_9t[itFitE$tHt92uˋiiuf[^_]Ëi떋i뀍U볍v'UWVS,utJTD$xY4$;Tts?ukw=h?t ,[^_]Pw,1[^_]t$s$J$utlj$O$J1EF8<-t;t-EtG+tBD$4$茄Eq\1XG<-E-tf$?kzj؋u]}]á$k5ku4FD$D$D$=\$$j뚋F$?$|N\$$t@$S rC|$$ BCt5ǐD$$ #CD$$awuof$A'~1><$D$ڒ$S BFD$/$:$m$~녋F$O$AT'fl$^ 0P$>$;M\$$3?$ ÉD$ B\$$PA$AQ,U$D$LÍvUVS1ۃuDD$4$Dtftt&h[^]Ã̋YdtGu$tu`D$ $RLD$Y$|>1D$D$W$l;$lpD$D$f$>;$"hBU(U]ut=E$D$fÉD$E$mc$:]u]Í&8[t]u]Ðt&xu$I g]u]ÐUVSE$g]h\$$9t$$9؛\$$n؛$ D$@ED$؛$jn؛$ D$@؛t$$Dn؛$ D$s@pD$؛$n؛$ D$G@1ҁĠ[^]ÐU(E ]u}Et $KEM $}/6$-6_E$6D$D$l$W0U$T$ T$D$-\$ ED$l$D$-%E$5t&5$5vjXD$D$$/\$ U$T$D$e-D$D$C$/U$T$D$--D$CD$E$O$4-$1.U-$t&4<@$ÉD$ ED$$D$,$.$4cU$p4&UWV1SEEuzEEt}UB8-upX@"UT$$OEt!U }!}fUS1ۃ$eU1uErxDw@uDx1ɨ uEruD wuD x1ҨuEruDwuDxED$ED$ EDD DD$D$$Ee3u$[]Í%t&'U(]]u1}1)D$-$)t5St"pt& M]u}]Ã뿍t&붡dE@0< vP$!É$!U\$B$tӁuv$I$!u؛$ 1Cf$V!É$L!t&=u:D$D$A$u\$D$J$fD$D$0$UD$B$QUWVS,E$ Lt,[^_]ÍvdED$$&tE,[^_]Ëu3%t|<$RB8B< wED$<$^1]uډ11 $,둍`$$D$?#4$w\$t$$s"$M;Y|gB$OD$D$$""E죸,[^_]áLtD$t$$!$)f[i<$f{PE,E1ңUE]HDÉ'U]Éu։$t4D$t$$@¸tB]u]Ív$xS]u]É'UX]]eE1u}u$HfUe3u3]u}]%D$:$&%t\H뿐t& E؉D$d$GEE؃[Up}RUȋUEȋRUĀ8:EtkEkŨ<$!EUX`BEȉ|$4$D$!UZNjMЅtẸk D A0EEDD$D$$G0 蝐?EЅEĺN ákED$$EލEމD$8E$qR11ۅ`t uu1ۉ$]gƋ`t  ut Bu4$6 Uȉt$$T$S 4$ t 4`u$`ED$`$D$ aEgfffȃ))ҍA0шDuۉTEv@ta8p@D$$D$̎EĉUލUEHyEĺ 4$YEĺ UЅ҉$ăEĺ U]4 UkxL\td\Ív1=U]1Ð&U=ktk(1Ív$#kk(1Uu1ÐUWVS Et?U11: t#:uD$E$u׃ [^_]þ [^_]Í'USÃD$D$$\$$C[]É'UW1VS tO"@0t4$Ћt)CyЋCluݍ [^_]ÍUt'ҹtTD$ L$D$$Åt*XT$ D$D$ $Í\Թ륐UWV1Sà u^t=CKx9@uuϋC>uà [^_]ËCo뢋t<ЃE  t%Eu؉ u1 [^_]Ít&'U$t$]u t9xI@у1$t$]Ít&$ҋt$]҃1ȍ&UE]u$ID$$1ɉƉ‹E 4$؋u]]Ðt&UWVS $#;aE1t@11$4$$\$$ UuˍU [^_]Ð&U(]]u1}D$$tIow $v?]u}]Ã뻃붃뱃t&맃뢉db ttE%1- "C4$D$uNt1Q1D$4$6w1f6C-D$T$ D$ $VC$[tJuuuɡ\tXD$ CD$ $D$똋C$8I넅uM}؋u]]]D$D$X$$>/}ډ]u]t=E1E }U;u}t܉S1t$$ :Ut B]Í&'U]B@Ít&U(]u։}_]Ѓ"%Et&$|$ t-uEՐt&,[^_]À*C1< Y>.y}؉ȋ])!ƅtޅ~REt: 04E EuΡ؛$ D$5u1~_1fE@9tEU܃04EEuơ؛D$U$9ut^~E79t>04E Euʡ؛$ D$p79u¡؛$,,[^_]ÍOt&ҍLBЃB< v>.^V} *t6C< mRÍxЍB< wҍ|BSB< v:;}4,ME'U]]u}xD$$tSvt5]u}]Í&`$$NF,똡dEtUԋBEx8o04U04U,؛UĉD$$}čGEG<\<%t0E04EtEc}벋Eċ}X%u-X&ÉD$$!uEE?.aEE҈UVӉ}EE=t$$u׍GEGEC<7Gw $D$D$, $t$$|4=<=(؛$؛$hvƉ$ $E ]v  <\Euހ>tٍU܉MUEU E믋 C<'<"U܉UD$T$C$ E}8 >"t Eĺ5GEá؛$UE EUm\$D$ E|$T$$]܉ 04t6ʉv؛$ E܉$*UψEU} 1ۅtAڣ؛E$uE;UE\$T$ UĉD$E܉T$$F]܉ 04^5ʉ؛$4 '5؛$*É։ډ11 EĺEEС؛$UE8< EU\$t$D$ EЉT$U܉$D$\{8r$840$T$D$-{BÐjvft 8$Z[$D$D$MZÅ$OU$ډED$E$ffC<'<"$U܉UD$ D$T$C$EE܉U8L>"/u1ۉUE11 EĹEá؛$MEcUE\$T$UD$ET$ UD$${0$$8u]1ɍU04EEEE|1D$D$$UĉT$$w.= D$D$$$v$$S*u t&0< v؛D$E$M04E%EEE1؛$\<*<-0< y0< vg8$2<8 $ ( ؛$%D$YEE؛$5t U;=t 5t+ D$D$$$u$$lQ=<v!8$7<8=(v! $ ( ؛$؛$KEE؛$D$&mEUĉ\$ D$E܉T$$E1EEĺEá؛$UEtRUEt$\$T$ UD$$\G1ۉEuE܉UEEt$ D$U\$$\UEЉ\$ t$T$U܉D$$+؛$D$$P$E}Ew$Df''@EĹEE؛$uE="EU\$D$ ET$D$PpmE|$ UD$\$$J+UET$UD$ ET$\$$/-؛$F&'$h3  t0UET$UD$ 됋UčE܉\$$T$aEUD$T$ 'UEĉ\$ T$U܉D$$u*پ+M]1tJEUD$Eĉ$U|yQ,؛$hE$s2Em\$|$$+؛$$ mE|$ AEЉ\$t$ ]111+MEU\$ D$BUE\$ T$EUЉ\$ t$D$Et$ }E܉E@x@$+1}R@H11ۋ@$01EEEt$\$$4EU܉\$$D$bPUt LUTP]ÍU(D;E]u}@90RPft;uY9E]u}]ËM :-uJZ-zLPT]3MT $P}|$ۉ=kExɉ<: ЃH ktBM D$D$$|$\$ D$D$ț$?fEDDPbDPy:Pt#8tD@}PuD;Ut"M @BD΄CktBE D$D$$|$\$ D$D$ț$M1=k@:9:D:ENDU]dX\`ÍvU(]] }Uu;+5;\`\XdBE<-t/u'\dEE]u}]<+uՋMqt<-\kXpE<:UhtrT$$tb@<:<;<#``<)`P`uX M$k k, XA``< ``E?ɉ XE?d `| uUM<:oJ1-t +X`X`뉍D U`X`6U`X-;My.\Ed `D tj0< gD U`X~*<;E$kk%,``E?gMu]E$kk+``E?)J`dED$@$JtXBX`X`XkUWVS1ۃ,EUMEEED$ $>A5w t&$,[^_]á`U:11ۡv  :uD$E$+uӅuv UK`|`xޡ`dҡ`lơ`p뺡`h뮡`t뢃M뜃M떃M됃M 늁M뀁MtMhM@\MvM=`71ۡ:uD$<$u؅ EMU]܅EM@MMD$D$B$UT$$<$'EUE U1$x '$?''U$ .ÍUWVSD$Z$^ t&:@V^uf t&(@t&?fa}@v@t& &Ie t&t&t& t&F t2$DD$D$$ÉD$ =$5Ft2$rDD$D$$ÉD$ $Ft2$9DD$D$$ÉD$ $Ft2$DD$>D$$ÉD$ $F$t2$CD$D$$ÉD$ Y$QFt D$ D$D$$*F t D$ D$ D$$<$1[^_]D$dD$p$D$hD$p$vD$wD$p$D$D$p$cD$D$p$8@D$D$p$^vD$D$$qD$D$$UD$J D$$ 3D$D$$sD$_L D$$HD$D$$#D$D$$@D$D$$fD$D$$D$D$$@gD$D$$XND$D$$02vD$D$$D$4D$$@D$D$$D$D$$&D$D$$hD$D$$C D$M D$$^D$D$$FD$D$$.D$T D$$D$D$$x D$D$$P&UE]P@N&'UWVS]"EEMEUEED$E$|xtplhd=E5d1„ttm}t1ۅut&w6tUF$uFD$D$D$W\$$21ۅu*t&[^_]ÍF6tF$3u݋FD$D$D$\$$별t v%dNjEGEG1t$$8\$$0hG 1t$Y$ \$$lG1t$+$\$$pG1t$$\$$xG1t$$\$$x|G1t$$R\$$JtG 1t$s$$\$$G$tM1ۉ|$F$u6u[^_]`;11ft&'UWVS,]E1E1ED$E$|xtplhdP=ZjdN@CExt$D$D$d$+$|t$D$D$$$]dNjEGEG1t$$j\$$bhG 1t$$<\$$4lG1t$]$\$$pG1t$/$\$$xG1t$$\$$|G1t$$\$$|tG 1t$$V\$$NG$D$D$ ED$T <$D$t@u(E }tFuEttFu>4$'<$,[^_]E:v1ۃ,[^_]Ít&D$1ۉ4$&D$D$ D$D$E$]É$$m-?D$p E$É$k$A-(US]t;ul[]Í&D$=$uω$K1fэ&'US]t;u []Í&D$=$uϋEu$-7tBB1뺋E D$$D$U¸u떍vUVS];tpD$$<=uX$4$\$$T$D$$|Ut@B1[^]Ð[^]É'U(uu]}>u1]u}]É4$25t@t$?[1t$n$\$$륋 t4$5t@ft@낉4$%E̛f:t(_MUuU8=u5Et$$D$muԍvU]Uk~$wkÍUk~$Gk~kk@퐐UED$ D$D$$+ÐUEU D$D$ D$ET$D$ E$JCÐ&UEU D$D$ D$ET$D$ E$ CÐ&USDU eE1ED$ ED$T$D$D$ $B$G$\$$Ue3uD[]t&USDU eE1ED$ ED$T$D$D$ $=B$$x\$$pUe3uD[]U]$ Í&U1҉$+ v&؉D$ED$ T$$x $ÍUWVS } uEt$|$$Ay 8t݃ [^_]ÍvUS$9 ] t.t*۸t  []D$D$E$` ~$$[]Ít&'UWV1S }fE |$D$E$nyu>8uu̓ [^_]Ð@UUtҸ`u]Ãt]1Ð&UUB BB B ࿉BljB1]Ív'UE` 1]fUUB"߃0B1]Í&UE` 1]fUS]$nx ][][]fUE D$D$E$Í&'UST@eE1uUe3T[]á`]$EdEhEġlEȡpE̡tEСxEԡ|EءEܡEࡈE䡌E衐E졔EEZ\$$Jt&UST @eE1uUe3T[]á`]$EdEhEġlEȡpE̡tEСxEԡ|EءEܡEࡈE䡌E衐E졔EEZ\$$Jt&UST@eE1uUe3T[]á`]$EdEhEġlEȡpE̡tEСxEԡ|EءEܡEࡈE䡌E衐E졔EEZ\$$>Jt&USTeE1@uUe3T[]á`]$EdEhEġlEȡpE̡tEСxEԡ|EءEܡEࡈE䡌E衐E졔EEZ\$$_Jt&USTeE1@uUe3T[]á`]$EdEhEġlEȡpE̡tEСxEԡ|EءEܡEࡈE䡌E衐E졔EEZ\$$J t&U@uD$`$KD$$7@Ít&'U];&U@tD$`$D$$@ÐUWVSLuM xu>1}T$E D$Eԉ$EtEЃL[^_]Ðt&뻋E$ED$D$ ED$UEԉ$T$UEЉ$P Ủ$9E$,>$,j?EEċ@E|UЅuuEtn111vUD$T$E$ZU{@)ЉD$UT$E$tU\$t$T$ Eȉ$9}sUċEJ$ U$Eԉ$EЃL[^_]ÐUXEU ue5u1]}EUEĜ[^_]D;WEUWVS u} t#F~1 f9^~$ׅy [^_]fUEu]1ftE]U8]]u}ta$Bv$ U$T$ǍED$ E D$% UUGE҉GtU]u}]ËM1tEݐt&UEtPtt E] ]Í&'UWVSu} tCN~<1&fT$ D$D$ $59^~uѸ:ʃ[^_]fUS]t tCu1[]ËE $D$N tk[]US]t"t$][]髺&[]Ív'US]tt$dC[]Í&UVSu$ Iu#@C؃[^]ÍF$Es~19uC؃[^]ÍUWVSuEUB$WMEQ1M4U01t$$輻$m\$$eMM1E9xMҋAMAMAMAtE[^_]ËMˋE UVS]u tJ9s| [^]ËFD$$S9։|v9}s؃[^]Éu[^]6UWVS,MEt E@EU Et U RUE$E܋E]1M4U01t$$T$\$$]܋M;}1uE]]}~Zu1M U1t$$$\$$蟺]܋M1;}u]]E]܋M؉K,[^_]ËM1ErUWVSEU EUM]IۉMt ][ۉ]u E[^_]ÍDD$E$ۉE~x]1ut&MU1t$$$\$$褹]M1;}u]M ]CE[^_]ËMEޅQU[^_]h&UWVSM<E/X$E $U :EzEM9Ey8t&E EMUET MU~ExtEx&EE$bËEMU484$D$?EutM8$(UEM9J8~ }8t 8lE끐E[^_]ËEEE&EUD$$请rE $D$蕷7Ey $跶EEzn$薶E^$膶EU1U t f u]Ít&USUttӉ$Cu[]fUS]t$][][]Í&UWVSU EUUUu 1[^_]ËtEEU u9U}ԋU1E43&$ƂÉ|$$u{ENjE+E9Et%Eu$:葂Ë$ 뻅e[}[^_]l&'Ue]vUWVSu]4$lD$ۉE~1U9u]tXE<F6EtΉ׋u$ [^_]à 1[^_]Í'Ue ]CvUW1VS E$$ƋEt}EGEu> [^_]ÐUWVSL Ee M1ɋU 8/`Et t;t6EuMg])3[Et\‹EEtp\띻둻녋E*EhZUħDX@MMCЉE A<w60#Et(T9tME]LЉM A<v]Et :{M?1EEE]C%m}tyB<PE 뼻q b S D 5 &Etsu,t&UPȋ]E EDCt0B<vԍB<wPPÍB<w6P2e}t<ى}ux\؃PMUE뾍=w nӃPE]M)1UWVS]+} G$$1҉1;] ~U 1ɉU19uʉ>uEt E[^_]ËET$4$D$ D$D$4$譣[^_]ÐUWVS֤EE UDZ]E$蟥U E$葥9EE|au19Et.E)9EEUDZt蹨9EuҋED$U 4$T$yuE[^_]Ã1[^_]y]bU8Auu }}]eE1t$|$$muF%=@t$Ue3]u}]Ðt&<$茤=$D$`t$W$|$D$ 4&D$ D$豨,D$T$$豟Q<%=@;|$D$ ;&D$ D$$I,T$D$$I<%=@$|$D$ B&D$ D$,D$T$$<%=@kt0 d,3`1 *,D$`D$$`ǢDžDžDžDžDž DžDžE&t7&D$|$D$ I&D$ D$$æT$D$ O&D$ D$$蓦! t€u ҋ)$O$sx.t$t=wƋD$$ ,T$D$$ɜuX\lt 9t9}94)E$$R t ̿Կ DžD$`ȿ$ĿT$؟D$`D$4$ 31 l;;뛐UWVSu M}]F>EE߉}C%1҉ B0v"#BWv=Bv>_v1҉uEtfEt: t5gfff#))ȃ0C 9t&Eu;C[^_]Éȃ0uvt&E -뽍E-ȃ0u% Uȃ`&uȃq&ރe}C0 XEUD$D$S&${ST$<$D$H[^_]ÍB0E{00v v3ɉx@gfff))ǍG0׈uUA0ӃBȺ)A0M˃A뛐UWVS,U]u }eE>/EjEUzG}}]EEUMU$t$L$ T$щƒw" @0v,w#BWvw=BvЃ> ȃ_EU$t$D$T$ IÉ uEt}}$fEt;} t5#gfffMmE))ȃ0G} YE܅u=,G[^_]É؃0 umEE  -뻍vۃE-t&؃0 u} }t&mU"؃`& uډ؃q&؃e}G0 XE܃:D$D$S&$-WT$D$E$U:+E,[^_]ÍB0E܃00zve]uxoD$ D$ EU$T$0D$ D$ UM$L$NU ‰Eu wC0zBD$ D$ $t$0D$ D$ $t$EUFU8}} eE1]]u/v w)$|$藔ËUe3uf]u}]EE$脘u7ӍED$ t$\$$蟕@v9t)u1輚UWVSueE1} pD$\$4$t2|D$\$<$yѸUe3uĜ[^_]1=U(]] uYux-ED$D$T$8uUft Efu]u]Ít&D$‰$. ED$E$,tEtE]u]áț$iUW1VSEu EËE\$t$$~ )Å~u~ԋE)؉EE[^_]ʐ8tE␐U<D@,]U],ÐUU@DB<BB BBBB$B kB$B(kB,kB0B4B8B<B@BDBHBL1]Ív'UU@BDB<B ,B BBBB $B$kB(B,kB0kB4B8B<B@BDBHBL1]Ðt&U$ n@@@P@*ÐUSkD$@| $&kJD${ $&6D$ \ $&"D$] $&D$0W $&D$PW $&D$@| $&ҚD${ $&辚D$ \ $&誚D$] $&薚D$0W $&肚D$PW $&nk[]fU ( ( p$"l6HH$lZy l@6, (%$KNfku D$$CI1áC-),k$EF7Лq؛o $Sp$B  gvUt @%à P%Ít&'U]&UtB$uÍt&U(uEu}} ]EFwl<<\uoSҍvpW   =,t$kk$ҡ%uC= tku=k1ۉ؋u]}]À1f4$u <&C}kC4@% Ӄ‹El4 rzB J  7t&[ $1$\$1ۉ$؏$ &CuE ]u}]$CEE 뷍t&u4$L!ek1ۉD$k4$D$x FMtSD$4$D$1U]uU}]41ɉrzB 1$i ufEt24$V 谌ډڋDXu)} U%M8Vv运ȉ4$ 5 &vUE D$D$4E$É'U]Ӊ}ωut*tM]u}]á4upW t0v t0D$$Z藋Dxuo\$$<럍ȋS3C0v U $D$ USn<$ 4V $ 4>hы뀐&UVS]tPsKS$tbtCtpt$l[^]ÍvCx:CD$C $D$| 눐t&;%[^]렍Uku=k8t;D~B$t't$t =c tAÍ&D$ $,똡@uDu eU$ ED$$  ¡tn;ktKtMk$D$‰$t 1ÐE;u;$t Du $1u/t&? D2 (t&UVSI,$$褗\$$蜉D$$",ID$\$$P$ B,t$$N4$F t#D$$?U1u%,$L$\$$[^]Ív'US( tЋ u = tft uI=kt t%[]D$i$ uۃ[]tt&뱡tu$Sá $D$d $跅$oUS]t$لtE$ $辕\$$趇£t.$1[]ú:1Һ:fUWVS\=BE$_t $qL5$u$t$&ǡtf<$&D$ D$$CE؍E؉EȍEEEȍSEEfEdfEEEE}ЉUfEEEE EEEED$D$4$ށ4$&\[^_]#1퐐U1u%]ÍU]li ll`ÍvUElE lE]lÍvUWVSDu=EE@9EE t. t)9E 8~!@Q؀ t t;]u t u9E~EE @SȀ t o;Euۃg1[^_]ÐUWVuS{tg@~X tV t 8 tp tk t> vt6@@x t u@u[1^_]à @w t uރ@R|&UWVS =D GEMfm}@9UM< t< t B£@9׉~MU< < t9ߍt&~@M  @9~6M t* t%Uƒ9أ@tJ t u㐍P@m}7 1[^_]ËM4:щ+E@9WA< t< DՃ9ǣ@EP@뗍&'UE ]k|1Í&US E]D$E $D$] E []UU[t"~"{t}t ]t1]Ã(t)fu]Í&U @~%`t @w&t@1Ív<@1 ÍUt]1D@@ ]vU]@SvU @%@w@1H ÐUt]1D@`A ]뙉'U]@svULPtLk1$1ңLDŽB u=ǀ0B ǀpa @lc @Tc u=s u@D0B 됍&UE E]!'UWVS }~`P1u9tIPt{@dt-P9@uыE $D${9u& Pu Hu 1[^_]-1H [^_] 뽍'USH]t!~E $D$*2P1[]H΍t&'U]u։}ǃ @q%x83yv t؋u]}]f$t$|$ۻԐt&UVSqt1ۡX$;'9u[^] UuƉ]@;D| ]u]xt t@]u]Ë@t$$;@uD@먍'US] ok$D$D$1[]Í&'U@t;Dt 1Ðt&wv t -@1D$@D$$t@봍'Uywv t -@D$@D$$@t@É'UWVS@} ]$Z yxt&9tEvt;D$uu@1[^_]9\t|vt xM$uf\$D$ D$$t;DZ[^_]Ãuvyuov@$ul|$$3;@uˋE@n[^_]ÐD9}ى|$$@$tDžO뢡D$\$$4r9ft&'USE ];tb,TFvu?$@H PD1[]á tDdD$d$@D$ D$[]á fftTth O 6  D$$dZ¸ZtUD$$d&t~8D$ D$d@D$E$ɉÍUVSE $D$ @D9}  t t1[^]Í& ؃)9‰@tA< t< t1[^]ÐUE]pUS] $\$& \$$v1[]Í&'U]]uu }=@~?rv (rv t6)@@xW|$@$V1]u}]Í&D$@D$$n@@yt&@띍t&t$$fۋu]}]]Ewt&'UVS]u D|$$+#u|$$V1 1[^_]Í&E$5g [^_]ÍvU( eE1u_u,E£xҸx+EMfU$U@M D1Ue3uËxEUVvfUVS] ueE1xx!‹@N‰ЋUe3u [^]ufUWVS EEDEE@;E=v t t@ @;M  t&q0Fu7_t2 @;M @}FFu9_t4 t/ u(@;U@} Fu߀_tډуm}A@t ;E6 1[^_]ËEQ@4)9t&< t < t8)9‰@uڋ @듍t&UWVS 5FEm}@< t< tU< V< Np8EGu1ɀ_G_t C@Åj  GuW_vtO@@xGu_t t vuЃ@m} 1[^_]á@@xGu_t݃@뼅ɐCE_<)t&S ҉@< t < t(t&ԍCã@ UWVSD=EEvm}@9]]o ы0V_ t} tx9]f~qC@FEME_  E9Eˉ @IPEFt< t< +9]"u @A< t< 9uރm}1[^_]f@Fu_u9]끋@vvUuu]] xBmDXt\$4$1]u]Ít&\$4$$]1u]΍Uuu]] xZ@t&PmDXt)\$4$7]1u]6]1u]É\$4$]1u]fދ]uu] 'Uuu]] xjD;@~*lDXt-\$4$]1u]Ít&]1u]É\$4$#]1u]Í&ދ]uu]'U1Uuá'T$$hɅÍt&Uu lklklit(at5k$D$ÍXtԀ8tfXt€8ftaE@~ .11뤍UWVS@ @} <%D$'$g8FЃ 5k kkDBУk'A(xk8u x `ڀBЃ w\ uk;ut [^_]Ãdt ytcuDt$$<15`[^_]$F%k%@kV%^D5`S Dk4$D$[DD9@E~@=<@9bip%EuTWu$}ctY9=1[^_]%k]9]~9}ӡ< t< tCã@gы^t1|$4$OÁ%t.ËE$1띍F|$$`OʍUDD$T$$ $kt|t$|ܐt&UWVS U1:t^ teUM40tJ0Eá0$F$7 u뢉L$$q]uuvt%,@D< 1[^_]T,@D< [^_]Í&'U$t$]u t^=j t =j t1,t'1҉؋t$1)É؋$]Tfu ]$t$]$1t$]Í&'U$t$]u t^=j t =j t ,t'1҉؋t$1)É؋$]Tfu ]$t$]{$1t$]Í&'Uщ]ut8u$]1u]Ë(xtX(7ơ($8sákuHD@<x]u]d_@g4$뮍U$t'ɃWU$tɃ'USÃͅC$@C(<訃%[]Ð&U ]Ӊu~Ev&u0@t{\$$u8vt\t؃vtOOv tq\$$]u]Í u]1u]]u]Ít&D$$럍FH$D$$9yt&UVS@(<@u%$tfGV@$[^]Dt&F,($t$ Q$=S$a\$$S$1ہ%[^]Ðt&USӃ$D$g1%[]Ðt&US]$~q‰t[]Íx‰[]w&UWVSӃ D$$qF,~@F< @Du:$3D$$7 ÉD$i$O1҉5uCt&4$pt‰|ufx [^_] [^_]ÃH* U1҉} /]ƒ/vU1҉} ?]ƒ?USDtÀ:uEB[]Í'USÃU$s Uع$`1 Uع$t Uع$2 q[]Ít&'UUtAkuvmuLuu"lt€8u @0v v]€8u@0v lu€8u@0v ut€8{@0v mp뺉'UVSӃfI8u'\$D$4$Sx؃1[^]Ã[^]ÍvU1@uá$CIu@Ðt&UeUVSӃt&\$4$LxC u1[^]I8t׸f捴&'U1҉ @tɉá$Hxܡ % $(,%,048<@DH LPTX$G x1@ $G U(uu]É}׉t$D$T$*Lt$G>]u}]Ét$D$T$KƐ&US]eE1$FUcuoE$ED$EĉD$EȉD$ ẺD$EЉD$EԉD$E؉D$E܉D$ ED$$ED$(ED$,ED$0ED$4ED$8Ee3u Ą[]NU]7&U$AFD$$F1É'U$FD$$aF1É'U`uD$D$$'N`Í&U`t$`E$ED$$`ND$D$`$M`Ít&'USdu[]u$Eáu=$tIx%d[]t&$dfUVSeE1dt!Ee3[^]Í&u$oDEEEEģEȣẸEУEԣEأEܣEEEEEltkk$Ohxl|pthijklmnopqstu l ɢvkE$ED$ED$EĉD$ EȉD$ẺD$EЉD$EԉD$E؉D$ E܉D$$ED$(ED$,ED$0ED$4ED$8kw&|EEEEEUEEEEEEEEEEet£kE00tnEugMEāeEEtEĉEVx+$E dRe듍&E$ED$ED$EĉD$ EȉD$ẺD$EЉD$EԉD$E؉D$ E܉D$$ED$(ED$,ED$0ED$4ED$8i$=$<2@t _;,HUE9t"`!u=dɃ@]f ?u] U壈h]̔TÍt&UVSut(t$uCCuu[^]]C[^]fUWVS|EeE1UMEE@v \}9DEERUM]DM<DAt\6@v9u@EM]U MMÉƋEDptGӋ4zE9E~EEU9U EE$SM‰\t!tXt=̔pEEUD$ & D$ET$$>M $C;Eu 9]EU4|$T$4$AHu׋M]t$L$$u?]t ]$3A]UFӋ_UE]$:CUT$ \$D$Eԉ$`@M]ƋE\$ CUT$ \$D$EЉ$/@Eԉ$dFÉEԋEЉ$TF9ÉE:UT2UM]D1E:9M]E}8D=vuEUM]E؍EU܋UD$ED$D\$D$ ED$$>XE؋UD$E<<$=Q\]EEEEE]E%M9 $uA$&P]UT$$BUBBMe3 E|[^_]ËEMD$A$D$=M]UL$D$$ 71</u $C5p҉EtE$ҋE$5U$5D$jDƋE4$D$]6ET3|/t//ED$B$46lÉ4$3EĉE$3t$D$9EUe3EL[^_]ûEEE=뱉Ӄ/hB1 xU$3 lɉEu#t$E/$#2ÍvE$26Ut$Ɖ$ @蕵%ytNYtI tDntONt&tEt@tHfxBt tE ft>qt Qtt&۾똋$t$]Ë$1t$]g뷐t&$t$]UVSD$D$$1D$ %5$1 sXۺt1V!ƒ[^]ÐUWVSLMU EM UĉEȉʉ}EtE9)E̋]̅ ȔMdE̋MčT}̅EEEE̅9UMȍtU1UUUUU f;}tQu)ƅ~$1ۍ$ D$69uE9E|]؋UMUM؅u&kEt$;EU9U}E!ExEU9UL[^_]ËMȋUȋAU܅}Ⱦ]EE:E܋0tC}~Uԉ}̅u1)΅~v$ D$59uEuuL[^_]s ȔE D$ & D$UĉT$Eȃ$+/Et9E|EEnft&'UWVStxE$U܉ɃEp}!}@Dk@$Et,ED$$Z+M $B#%,[1^_]Ë]BUt M܅@{D$E܉$xCM܅ @sM#É$$7 ;t$"u聝E EEExM $r"hp Mܡ:T)M4룉'苯EMdƉ$ $7 ;3P4$!CMU$EWUE*]UE?]PUu+=` tH`u/dtE@]]3vE ]vE!]vuE?]zv'U]]u}}$W#$2ơF\$$#t ]u}]UWVS U }u`t$ 1ۃ~É$"$1\$$x#$"% (ã5t# :uӉt$T$ $'u$V"$1D$$"=~t [^_]É [^_]=& [^_] UWVSE ]t$l#t$at$Pt$?$w!$(0\$$ ";$J!$/\$$!D$/É$@D$$!F$ $/\$$!8~tt $Сpt$ЅXt2t(`D$$҉á$!$ңt=:t8Xt/ t%`$D$щá$ډ$1t&1$`n~.tuj:.W x~8~$cU$VD$.ơ4$D$|/6/D3U$T$[^_]f=\=F:VU$9\$E<$D$[#VUt$Gt$,1C$ ,~.~Df~.9tt&EFUEDBurEˆUUDBuE9FE$9\$UT$E$ t& Uf U<{T $.@6zE$$+UU E[^_]$$$+\$$wR$á$V$ËE$vD$&+ơ4$D$|/VD3/USU] x!Bvkk\1ңh[]áltً k9u1AX[]Ð&USEkkE D$E$ik[]Í'UED$$7Ðt&U E D$D$E$Í&'UEM S1 t%|u9DuDuۉ[]Ð&UWVSM }u 1[^_]tl11E,<uQ|tzB>t҉yԃ}t΍E<uZEHЃ<t|rMtMB[^_]Ë kI]tE؋utUMA#@9UMt(1ҁ lut&9 D9t@9u1]Ðt&UEtk] Uk]ÍkUtu k]Ív]k lÍt&k Ut ҸhL u]f]x2É'UXt5D$dD$\D$}2D$D$ ț$1ÉD$ D$2D$ț$Ð&Uht BhDD1Ðt&2V1fU ht3~D1:u<t9ȍvu=1ø861Í&'US]D$D$hL $"uk1k[]D$D$ $uk l0k[]Í'UEt8ud1D$ D$ D$$!1ÍUVS@9ut01@9tD$4$RuD9[^]Ã1[^]ÍvUE$t $1ɉÐ&US]t;uk1҃[]D$x2$uk1[]D$$tD$2$tD$)$}tD$2$iw0kf&UWVS 8t6118 tD$<$u [^_]þ [^_]Í&UWVS 7t6117 tD$<$u [^_]þ [^_]Í&U($]Éu}#~z1ɉ]Ew2G\2ƒ)ȃ0T3Kx0ڃ\"}]u}]fx\@C@@-[}ExUueMuGA\@e@\Su\@C@-@?@fڃ@ҋ<}8EuC؃@<}<ڃ@ҋUBEڃ@ҋ밍&UWVS$A)ƒ$!EÄt]uFw_\CMC-ti\"„ut\EPEuE[^_]ft-fyBt(\"\e\e\?CCC-\CC@C-XExUuHu"E%@ҋ<f8Eu.@<@ҋUBz@ҋōvUSÃD$2$ u)kx2t2t 2t&[]D$N $u0uݸN D$2$tD$+$uA[]D$ 2 D$ D$D$$ k mD$2$AuLptȀUM  U}u]?tӋDPT؃믋U1UMٻEQEDpuUSB<gPE<뺋}E  }Mu 1 MEU  Eu} > uUM  U}E }Mu 1MrEU E]u} >uHUM  \U3U E]؉EuDPul؃M} 9M>mxtŰMu U؈1MB<w PPӋ놋}|7C|7-u7?ӋDPu<Ѓ{&EU EJӋL4Ӌ3 UVS ]$D$ \$$ápt$<"<'E< t< tU< t< uދE$D$} UT$4$pD$Ep$T1 [^]Í&ESst8t9zUujfUWVS,] ut;u},[^_]Ð$ D$ E؍ED$E؉$D$#?ME1E~3,tCE֠CEߋEst-}}pW tE߈EEM5h9~lEBwlttst&9U<tM,t=ECEM5h9E؉$,1[^_]À}hIs뷋C$g몋p댋E؉$U,[^_]ËE$=V UVS ] $QD$ $ƍED$t$lu'Et$$D$ ED$1 [^]É4$fUE$D$ E D$ED$Í&UE$D$ E D$ED$YÍ&U1҉]]uu}} t+D$t$$~t"=pW t=pa t]Ћu}]Éuu} }]]]^&'UkD$E D$E$_Í'U(EEEkD$E D$E$%ÍvU(EEEED$E D$E$Ðt&Uk$D$ E D$ED$Ðt&UWVS<],< < <# <$=11<"UteЃ: < FƉUt4Ѓ: U؃< FƉUuED$$M< < <'T<"L3t < t< tLʄt < It< uEԅ;"D$-߉$tx919jD$<$$uދ49ؔut΀U<'#<"ED$ 4$kUED$@tD$ ED$$1 1<[^_]ÍCEC< J< Bu1ɉtH< < UAքt%< R< A։uߍt&91ݠ9D$<$uމ4$ݤ9v;Sft7\t "m0ɍPttP1Ƀu3t&<:`E؃UNUt/< t< #ETք< Rt< U< < ]< < vuEx.$@؍P9r @< t2< t.zBt9rBE؉\$$1< u΃9sfǃEM\]v< t< j311ɃD< t< t| FƉUt< t< FƉUuU$K$S1311#\t""3Qtو3ݍN Ev<\t ;}:f1At΍A1uy| =MƒЃEFU7M؉ $CUEtM؍T:kD$E؃D$E$1U'tn"tiM؉ $4$D$N4$1DpuhM؉ $4$D$[1vqCM؉ $ut U؍D:t?k4$D$E؃D$tы4뼍EvUWVS|$U`E\N$EED$ED$uIUD$D$$$uċ]t*<$VU$>|[^_]ÍS9wω$!\$<$ED$<$&}U$UEuXd9s\9> 1)8 t 9Ӎ3ut< tN< tJt<#t 4$v[td9rE$U1Xu뺉1돡@9E>t$ E$>$UT$$@E$:z.yvU1=]u}t ]u}]ËED$ =\5d`$tES=\5d`먍&'UEt8t.1F@u$4kjuԍ&1Ҹ4tɸ)41v1ÍUS$}v؃[]Í&'USE] t \$$E\$$Ð1[]Ít&'UVShlu9|' DBlD$ $Dh D =ht.< < Nʄt< I< ut D$D$644$D$D$<44$t'4$D$ 1[^]Ít&^D$ $;k[1^]ÉS$<$\$$D$-$t\$4$m1҅uS$1[^]l$DpD$hL $ @4$D$땐&US]tB;t=0t$ $X$ \$$01[]Ã[]ÐUS]Ct$Ct$Ct$][]UVSÃxwP,@D$$jqxt$TCS0xC C|C,9}_)D$$MC`x_C`@)$D$1%t[^]Í&)D$$>C`yC0;C,uC$C`C(<뉡$C`䍶'UuƉ}׉]t 8E!$L(utf i-se@archf@)`@ tt$$ E': \$$7 $ ]u}]@Creve@rse-@ q$E!9'UWVSu k8u@@= = =s MYD\$Ad$)ttE1[^_]v tA}WDxKjxftp$t&g1rht$g1뤋]SDx {HOUBDw%$D:}GDLBvu됋MA Q9vUB ыRA }WG E`PUMy\+y 6]C`ta]s tH؋K[`PX:t MY@Y`EuċE9x`čt$T$ $tűEUBEUBZ9}$51ҋ)9u= [^_]9ǣ~=D$$D$$q;=~=$$5$$$ [^_]Í&UWVSEUeE1Mv /=#x);v59]U=  M: MuMtM:uEEu9‰UuۋE9E >v U)UE;t9uME +M9M U:v )ȉ׉E ?t9u9}9% vSO9։UM}ĉ]]}|U!9MZ$bt ;E x5l UMT$ $n v MċE+M+EȉM)Mv MME+uvEu19EE+ t(E9E~ ptMt$ $ESEEe3n Č[^_]ËE5lMEL$$N5 E;xv  xUM)MEE;E;[ = U~$EEM؍UԉL$ $D$ED$Í@k  $ D$BE8 UM19E 9MC}ĉ]:GE< mm!E;usE9Es UM:tЋE]]}95p;u;D$M D$$dt$$P蕿v V 5Tt&;hYE8t=W,t t0M9Mt(EL$D$d:D$D$ ț$pUD$$T$YD$M D$$MEL$$OEE+EX]]D$$OU)U1ҋM)] E9u9ۉً}uމ]+Uuȉ]UUE+M9EEk`ME9ȉMKtu Exta}tZM; Ot 8B:t8u1ۅu-&D$M D$$C;]uڋ]#MEL$$MN<v OEE)EċMċU6U)UMUEE)E!M+E]D$ $D$ȹ}D$EE+ED$E$裹E;uE9EEUE+UM+MUЉT$UM̍MD$EET$ UEEEL$D$$ M1U9 $D$!EẺD$MD$EL$EE$ظE;uE9E7uË}9ۉr5leM 9MEEEEBMU:E11ۋuEkU\$D$ D$$M|$D$ D$ $uމNjE+M9MEM>(EUD$EM|$L$T$ \$$蒻e+UuȉUef~VUt$$KM pv4u+uu$|tU;)+}+u*)v ؅tM9M} ^$U;p]軹t aU:UEJMEL$$JU}EUD$$SUt$$KJE1_Uң|M; )Уtt 8gt58t0U1ۅu%D$M D$$;]uۋUMT$ $I|8D$M D$$:UED$D$$D$ D$D$MUMĉU:4UMUĉM:cv EUEĉU8MuEMUx+EEEE11҉ËE)É`D$M D$$9|sEuEEU%1ۅt2UM:UM] T$ $\$Muމ]+Euȉ]EMͶv EݽED$‰$U:ML$L$$ٽUD$M T$$d1K+|$ D$``E)EUD$ D$$T$袴MEME'M)MED$ D$ $D$lEEuEEE7MEMEԉ$?^ۉ~!1ۡMD$ $蒾9|=EEMU؉T$ L$D$Eԉ$Ѷ-%@vR]Ӊ$jD$E\$$襼UMt$T$ $/6]$뫐UVS$d\$$蘹\$$臹D$ $豵tÉ$裸v t~51ۉ=~~td 11&ڃ9}4x1[^]É1҉sD$$SL CDt 1럋U]u}tID$ $薴t0x<$臷ƍ@$6}ED33!;u8$ 1UDu}؋]]É$ƍ@$1t$D$跷릉|$$觷r&'UWVS|eE1=U E1E5:!;5tdht `l~8MD ;dT$D$E$DZlE}U:l+p|D$D$$6}EE;=v诰#]5l9|v39t&#U١d;~ӡd\$D$$:u]‰EhE|Ћv +=;=u(Uίv A EEU;DEEMv:u0EV ESE$;EEE9EU;@WFw H J UGM_ ^;U|4B9EZ EMЋU Mȉ   ?UЋM 9U1B9E7E1ۡMU Mȉ *v EߋU;DsME= B;EUMT58t `M9 `DE1 MEM=L)ыU) $M؉\$T$E؅ E EuU9 E؅u} @EM9M M؋UE9\4D:=1NuhDE}:18uڋ]UMڡdU)7= |)ˉM܉ pEMt)ơVUUU顬ы)9Y )Tu܅t ;]}]̅ U1<;E}MD> t`u ;] !EܡEE`D$ȉD$E x $1 1҅ۉu|);x~9Eu9 ~)ȉ$U#|))¡9~D$)؉$$衭  xEe3 |[^_]Ðt&Eċ9i9a.EUMȉ 1ҍ>;]ED ;u|ӋB;ED$$D$$aD$$ѻD$$趻U;@EME Eu))Ɖ+EÉEԡ99uIE1ҋME 9uE‰U$EEED$ D+ED$ED$E$E8UM UB9EE1ۡMU E_Et$D$ `:D$D$$轰9|2)B9EME)MEUM_ ;UB9ED$$ӹD$$赹)B9EME ME)9ueE1ҋMEt& 9uMʉU;EAE;@Ehuu9us,UMMӍt&ӈ9u+uuEĉ1-fE1ۡMU Mȉ ;u;|B;ED$$lD$$Nt9GE1D$$D$$D$$ʷD$$謷j|5nM*AEE|xc/@DP@D$$D$$^EEEEE;@]UMMD$$~D$$`ED$ DEED$D$E$8E$$D$84l]qWF1 D$ 4$艤ut3`Et#)\$4$3~ My tE$DEãE;EU\$T$$ME|8w-;E|9M; )У.@I%)) L$$lD$$QlE!UUg|;xH;<0XK+$:ϡ;E~`9|\4$e9=|80<$\$$;=u$+벋EU;$vUt5]/|tp' ;~XdtOtD$M D$$蘥d\$$0袟v R8|)t 9av t ;=$|$D$$D$$αE+|uڃ17^Mp|tM<).l‹M%)) L$$5D$$E,vUU<)8)]|+贝v t$ޡ91)$-51+5x蒤D$D$E$BEd1\+|Ue`bt@{Wt&USt =tdt =tĤ1[]Ípt$萛\$D$@$x1Ĥ[]Ípt$O\$D$$7\$D$$\$D$$\$D$ $\$D$`$מ\$D$$连\$D$$觞t&Uetɍt&t&'U8u1%}ω`]Ӊ$"G$hD$D$4$% t/hD$D$<$y]u}]Íh% ufU]ӉuΉ}Ǎl$莙ډt ]u}]ÍhD$t$<$[ېt&UttGt t1Ð@$ L1$@D$$@蒡D$$@~D$$@jD$$@VD$$@BD$$@.D$$@$2D$D$@$&% N% :% & % bt ug`% % % D$D$$^tD$D$ $+vtD$D$ $J Ut $U k1@vE$ҁ%ÍUuu ]wuptx$P\$D$$Ht$$茜Wt$$D$\$$ ]u%]ÍtsUE]0 ÍUE]0Ðt&US]$B$\$$[]ÐU)EDBɃÍU EB Ít&UEB Ít&US]řڋDXt UӋ[]ÐUS]蕙ڋDXt ՝Ӌ[]ÐUE E EE]&UWVSE $0NjE$#9ljE;1t&E)9'E|$4E 4$D$/u׃[^_]Ã1[^_]ÍvUWVS@Dr9tt 1<~t)< t"< txT < t < tuB< t< t9< t9<1~vt>1[^_]Ít& <~u$h>舘\$t$$(NȍE)uEE$賧ËE$D$D$ʔE$'E$耖|$t$E$M1[^_] US] 9|) D$$蒦 9~׃[]v'UU#1ÐUE#{N%tfuD$$訕t&U]&US]$u 0҅u []Ð:\$$`1҅ƒ[]Í'US]eXu 0҅u []Ð:\$$1҅ƒ[]U}U }]u9~Љlj)C$袥=\$|$Ɖ$辒]u}]ÐU1]É'UWVSEUVt~1ۃWW9uNW<$VD$ED$$dtt8t[@$Z,kt$?$Փ1[^_]ËE$D$$7 ? $蘓 v봍&'US]=+ tq t,U 1[]ÍvU $ ҋ u!~$ !‰y  Ӎ&'U1ɉEU ]/ Ut'@$*$N>1UÍ&'U]u}=, t%=, t]u}]Í&tء44$@)ljxt# :uT$t$ $艘u\$<$9=@xD$$1_֍t&U(E]u}Ud /D$$eEkU<<$ƋE$D$虡ƋE|$4$脓U4$T$%<$mU$bU4:k UjEUEu1]}]ËE4$D$|$4$蛕q$܏ 1ҋD u1$褠Et&'U<]á@u9t)T$$ۉu1@1;<]1u]Í&<D$@$6뷐&U҉]Éu5@}=<~OD$$-@D$$</1.]=<}5@u]Ðt&D$$.@D$$<F-믍t&UEx ]K؉E]UEx ]+؉E]U1]t&Uuu }}]9t(t$<$t$<$]519‰]1u}]É'U@u 1D$$x=k@u<1Í&UWVS @uÉE=tCۉT;u t t/uC @uۃ@u\$E$=kti 1[^_]Ë@t t {/rCÅۣ@Z K B/9Cȡ@< 1[^_] 1[^_]þ&UWVS =@]5vtSt tk tf t݀ t؃ 0@t t t@uuD$<$=ktI 1[^_]Í @t  t w@u@G@< 1[^_] 1[^_]ûv'U%D$@D$<1ÍvUSEU xO@T$$)@9t D$$=k@t 1[]Ð<1[]f؉E[]USEU xQ@T$$*@9t D$$=kt1[]Í&@<1[]؉E[] U<u5@]9~Ƹ9$k!؋]5@u]É'USUE xP@D$$!@9t D$$D=k@t1[]É<1[]E[]&'USME x_@tED$$!@9t D$$=ku@<1[]Ðt& 1[]ÍvE[]UEu t9Bt&uE BEB1]]Í&UW1VSEOË%D$\$$K$tmtiP wptpt~HMtUtcE4$D$/5@Yv[^_]Åt==t&1 @M륋5@덋 DM뒋5Dw}%\$$D$J$k@ 5@$2@ $賆t&US]|ut&;u1[]Ív'U t0 uku<@1{'UVS5t1$tCuC $ӅӉt$D$$[I[^]Ít&U$]Éu։}UXpxP ]u}]Í'UEU M$EÍ&UD$ D$D$$1-Ít&'UD$ D$D$$f1Ít&'U(uu }}]9~gljt$<$\$ t$|$$D$ t$|$$]1u}]Íu獶UVS]KSC$P[ 1t$!$Ҕ\$$ʆF [^]Ív'UW1VS ]t$$lj$xtƋu [^_]ÉҐU$ NPPÍ'UE Í&U]&UWVS }ttuD1t4$$蠓\$$蘅$l9ũ 1[^_] 1[^_]bUMt<)ЋA%E E" ÍUSu^tHt,$$蹒\$$豄$t& 1[]⍶Ut$]t$.%Ív'Ut$t+BB$谀 tÁ%Ít&US uLx t=tءtHt<u9؃[]1ۉ؃[]Í&U9|# t>BD$ $Z UÍ$誐뾐(;$U]Ív'$(U9~])ЃÍ&])¸)Ðt&$19(USt$@B=$~ $[]ÐU1҅t$$$xU$@]$ݍ&'(;$U]Ív'UUx]É'US]1҅t0ڃt.(@=(~ ([]Á  뷍&'UE ]1Í&U1%]Ðt&UVS u]tM+z ftKu,4$yD$\$$!}uE [^]u [^]É4$y$6yލ'U8]l}߉u$]y1ҹ 󫍵 󫋍lt$ \$UUET$D$$q]u}]Ð&UE]u$"$]u]ÍUWVS<tE,E<[^_]yu E5Eu  $ `E߉$w 󫍽 󫋕`ED$\$EED$D$ $wÍED$D$T $|tv]~Wj9~E=EEEt&$É$&t t u̡ j;D$D$<$̀D$<$ÀD$贀ED$D$<$y\$D$<$E膀]n $rfSUHE$T7$ Ec$Eyt&U(]Uu]u eE1}T$D$4$MxxO}~H17EEED$4$,wu! @%x9}Ue3u ]u}]}UWVS1ۃ<} eE1uEEEE>Sf3ED$ E܉\$t$$xt,u=E9UEUt @%yUe3u<[^_]Åu|UWVS$}EƋE'vUk8u6x0v u-3uu4$#4$w[^_]É$ڐUEt]w]Í&'U$ ^U@@É'U%lttfÍ&'Uu#t $fUSl}D$D$$`xD$$~t& @&D$҉á@$uFu" u.uu[]$tf$átV$l8u}ulu}kv t590$Í@v +yfDt$SDt$b%=$#$[]á$@5u%=yeoD$D$`$Xv>țD$AD$$:D$ xYpt&US] E$l []UUM tt] UTMt+Pt"} tt&D$M D$$v; ktuD$M D$$vÍv'UEt#4tD$M D$$fvá8ut&Ut!tD$M D$$#vÍ'U tkt1t/Í&ț$D$?wț$s1átщ$D$M D$u1Ðt&U $ D$ y1ÐUVSut81ۅ~)t&D$M D$$4u9u܃1[^]1ۅ~ $D$x9u1[^]Ð&U D$E$jxÍt&U D$D$ E D$E$KuÐt&UWVS 5}t/71ېt&`;8u|$$xtuۃ 1[^_]Ëd; [^_]USkk$D$@| $y(D${ $y,D$ \ $y0D$] $y<D$0W $yDD$PW $pyHD$i $[yk[] UWVS,u ED$ED$T$pu]}u u{ۉ=r=D$$=u-,[^_]$- t%D$ D$ D$$nCۉ5fFP)t1= $:s$- t%D$ D$ D$$om닍&s$:}s] UWVS]Et $iE= t$m t$}m [N:p1|t,0($HL@<D84 PTx:ԛ:ě[^_]ED$E$~ Oi=   1}E \$$kt&`;d;|$$ruܡ1tԛě-$:eh1ҋ=5p$;htc l1[^_]$B \$;gXQ$;gu tD$E$* t*1=:$z$z  t&UE$[1Í&U=]]uu tK~~7 5t]u]ÍFf$릍t&'U]w&Uuá$dD$$= t鐍Zv'U$dD$$=Ð@DU9~@Ut<9|x$]fy@f]<Í&]<Ít&U1]@ DU]@1 U1]É'UU9D|<1]Ív UEu@E]fU<;Dt@@<1<tÍ'UE|Rt*D @~1=k)9| @Dy D1É@f؉Et&UU|Cu@y @1á@9)У@׍&@ډU4t&UWVSE }@Eu [E ~ ;DE\$D$ D$$+b+&\$D$$'`9É„t^ED$E\$D$ DD$$^uZu\$D$ D$$a9É„ut>(s[^_]Ét;} tj@uƒ1[^_]á\$D$$Y_6} ušD$\$$1_명&sD$ D$\$$`pt&UHuu]É}eE1MD$4$L~x1D$ t$|$$‰ЋUe3u*]u}]ËUۉD$ t$$T$hUEuɹ>$&@[ D@@1Ðt&UEuɹ$@[ D@@1Ðt&UE]@HP&U]]uu m`t$ uu"]1u]fu u]]]\$D$ @D$$^áD9| kt99@tND@yDۉu u]]],D$D$$\j뫐&U]]uu }_t4u+|xt¡@uQ@]1u]Í&u u]]] D$D$$\„tׄt@ۉu u]]]X&U]7&U]7&US]E Pt&@;DD$$Z$V@;Du7@;D@}gD$$Z$tJ^fv¡u@D$ D$D$$\;D@|f71[]á@;D@HD$$Y$}']vu@D$ D$D$$,\ۉE ][]&UVSuE v@u6@\$$FY$u?ۉ@~5\vơu@D$D$$Y뤡@u4fe@\$$X$\t?ۉ@t5]\vơu@D$D$$-Y뤃1[^]މE u[^]Tt&UWVSÃ\5@UeE1D$$!E@ULEEE4$D$d;uEfEu9ut$$WY[v VU$%t}t&[t u À&^DXu8ڡ0u9u_E@1Ue3W\[^_]bӋ뻡D$ D$t$$ZYE5fEt4fE4^DXe\ӋUEED$ E)D$D$EЉ$[tn]Љ$cl$b;E[UD$E׉T$$B]~D5U׉D$T$4$@ZEu]Љ$]$d8v`UE]? UE] UE] U x$t@1;D ‰$k tJt @t$u 1Í& 1Í&Dtܡtl$u똍&'UVSu @I%[ڋDXuQBt^A1[^]ÃCtODufWv tr\$4$ZӋBu\$4$1[^]Wv t;\$4$낍&\$4$1[^]É\$4$U\$4$D'U$-$D$X$蜀g~1É'UtE D$E$1~1Í'Uuu]}} 4$[; }9t$$[DtE]u}]Q$8뽍UWVSUM 9~ȉщ¡D9EM֋E!։D$4$l})ED)9}'>t& D)9uOEt$$D$ ED$D)D[^_];U^UVE$W'UWVS @ۉt < }< ty5D9}  t8 t39tT$$@@y @ 1[^_]Í ։)9‰@tA< t< uލCã@t< t< t avC؍t&'UVSEU @~'T$${@$D$Z1[^]Ð uSt t}@@4\$$@;Dt1؉E[^]|KWыDP@t١tЉ$\$d$,1]@D$D$$7P\$@$1'U(]]}} u5@;5D~\Rt&v t5|$$)@4$D$15@]u}]Ív|$$fuvRv t9@D$@$:1릍ۋu]}]]D$ D$@D$$PSvDUMU t;@t U M]]t2t&DUMU t;@t U M]]Tt&U(uu]}t>u1]u}]Ít&4$ VEt܉D; D@9| ; @9~Ut$T$$Qu-}tL@ED$ $T$ЉD$E@¡DD(tzuJ; @u+BAB뮉$膼$U1WVS}@=D@;DPv @)ã@C$Xc1~ 1ɋ@19u0@$D$@D$ |$D$$eN$@4$4$Q1[^_] [^_]á@D$D$$%L&Ov t@ã@@D$D$$Kύt&U(@]]uu }E1u ]u}]Ét$$@t$$EL=@t$$:@t$$E@9}E9ED$E$ǻ<$ƋED$趻E=@<$D$4$bE@ED$E$$@E@4$/P$'P1wE@t&UVSE $D$0t$ RtS:t2f$D$ $.1[^]Ðt&t$T$$TVu@D$$뭐t&N oUWVS<]eE1Lt5U EEUߍG=o,E Ẽ$_]̅ۉ~#1ۋUЍE߉D$$T$L]9]߁~E04$z)uۉ4$rN1dfUe32<[^_]Ë=d`U X5\D$ Xh`D$ED$h$|Mmt&-`EX\E>Kt U $_1uF$g^1~$1ۋEЍU߉T$D$$xK]9d<$%<$!M1X5\E߉$1dE EEݍE݉$1g`D$ D$hD$E߉$K``UD߉d?hED$ D$iEߡ`$h`D$SX\E)P'UWVS @uE1~;11E $D$@T$$I9u~1@D$E$腽@;D|.b 1[^_]áuơ@D$E$D$ <$ @ [^_] UEU x0 @t1 kt U E@U Et&؉EU0É'UE ]pU]uƃ @V⿉øxt\$4$(]u]9㍴&US]t$@u D1[]uӃ[]Tt&UE]@.&'UWVS,}eE1u =Gv 19tGGv tTt$$$@;D}Ƀt$$9u1Ue3u=,[^_]Ðt&E$.̍ED$D$4$eYMt&'=kUUE tE U]f]zv'US] E$D$E@$~W؃[]ÐUWV$1 t`8t[D$$JCPt~l^_]$1 Lt8u$1 7t 8wD$$jJ[:QN m1^_]ÍxT1吐U]kkÍvxUt4$t*D@9}'k@t!t7]Ðt&D@ku߁=kt]@Ív1;@]!‰<Ð&UE]kÍvUD$$k1k lÍ&'U t U~9D$$1ÐD$k$h1Ít&D$$L1Ð&UD$$&E $kD$)1Ðt&US]D$$Ck<Dۣ@u@<[]É'U]u5|t ]1u]$ V|Ɖ$AG$U\$$G|BB]1u]ÍvUVStI59pt>9t$\$$Ë$DCt$rD$jD1[^]Í'US]t*t$8DCt$)D][]D[]fU|t$|1Ít&'U|tAD$$|B$YD|@1Ð1Í&US]|xu1[]Í&=$t>ft&t&u$D$1[]<1[]Ë@u Dt$ۉ][]1;D א&UVS]|xtE=$tEt&k1t&tBfu$D$I1[^]Ë@u.Dt$렅uۉ][^]1;D ɍUS] ] E[].&'U%p1Í&UU|t$d|Ð&Ut+1Í&U1=k@BkRr]t%ÍUkk$H<D$u @%É'US] Uk8u x ڀBЃ w8¡t kB k[]Ã-uMhqssk%$D$Ht$1u1[]Ðt&=ku u딃tNtS 1]f] kk)%k@@%pr%k]E []QUSát,,p7r$%1[]É\$E$[] UEu)x)D$$~ uɸf蚨ÍvUc  U%kt1ÐZv'US] u$[]&\$$kk$H<D$r1[]ÐUUBBBB t ]É'U]ÐU]ÍUE;xt ]]1Ít&U]Í;Uu]1Ët]Í'1Ut]Í&'1;Ut]Ív'UE+(;}xt]]1Ðt&U]]u}|19}'t#5tx"tU 9Pu}x]u}]1ɅE 9tt} 9xuMu}xڃuMxUfU U$t$|$y1ɋ$ȋt$|$]Ðt&9}ޅtڋ5tЍ1 t)Љ‹F9uC룉'Ut]Ív]Í&U]ÍU$K¡BBBB tBɉfUWVS t@0t:E$<ËF$ً! t€ta҃)ٍA$H\$$:D$4$L DEe3p[^]뗍2$:H tt$/~ 1ҋD9u(B2D$$7G|;&UEtPt :t1ÍBD$ D$ D$$~5Ð&UVSu\Ct$;64$s8$$Gt$$9C[^]Í&'U]]u}tGD$$s1t4$ 8$Ft$$8GCG؋u]}]Ít&Uuu]] }y1]u}]Í;5}$ LFE<$}7$.F\$$&8U_EB$P7$F\$$7UBmU$Ét$ t't Qt'u$t$]Í'U(]Ӊu։E}U<u]u}]ЉUT$$X<l2tsҋE$\<D$P2t6ET;E&>($uE$c<D$2sfEtG;EuEUu<24\uʋEU| t}'tσʉء4\$$1\$$c<x1t]듃}$-t<<s&f<>t</u֋}}}ԉ]&'U1ɉE]'U(}׋Uu)E]E<w$=E<D$At$ËE$D$.3:D3 U$T$T3؋u]}]øE<룸Eg<땸E<뇸E<vUWVS,E] $Etn1tt&u,M0$}$9}]|2E~1ۋ$~/9u4$r/E܃,[^_]9ʋUxÅx9]E]EE؉EU$f1UE9]TU݉Ѓ$@EE]EED$EE$1$1EU9U-UE E빍WU_M\;ED8E$h?E'UWVSLEE }UЉM̋MeU1҉EȋE EE|$ML$$)UuUP;ED>\tLu]tR;EtJJ+v׋ u͍ML$4$+\봋M}D9;E9]Uu Etx+E؉$G>EE19]}?UE؃ }܈ 89ډE} Mр9\u݋}D;EuЃNjUEȅtM؋}ȉ>EЃUe3Eu7L[^_]À>\}UD;E]1%O1t&'UWVSE.uEE}qn}xuhE|UaU7< < < t&-B<'uŃ܋E$!$P0UT$$E"É4$;]M $m!UE$D$"M $EuUE\E}E$!U9QvEUtE}ED$$-t$ft$OED$$D$&$?554$.E1[10<\;;uUȈ:Uȃ9$<&u‹E9:MȉD$$~ E/"uD$4$-E1ʉ$G.'PEt.Mt$<'tG< t(< t&t < tEEu'B'MBMB''B\B'B'E댋M$W<$t$-1|&E8$~Mȉ= 4$r4r<$t$,M$UЋE\UM $ u4$EUЋME$ Mu4$E$EE]1U\$$D$KEE\$$EMt t;uA$;,ÍP'$M$$[$ ,\$$$7'UWVS|EU e M1ɉE1҉U(=,3$+EE$UE:-XUEEE:EUU:E, 8Ut \t "]t' \EԋUEԀ< Rv kEu|0H]P1EEEEt&D+؍U؍EEED$$9uUԃMBED u]؋! t€u҃+]E4;u'E؉D$E)؉$UEM9Mt E$]u 1}Ue3|[^_]ËE$$_)UT$$TM1뺍&EMEԉL$$+uEԃЉE7/!vM0L$$ Ut$$ЅEԋM:,E$U$$(ML$$wU1&t,MD1D$4$\UuBu^&}"FE"+EE't;EЍFEԋEUMMEEEEU1EEEEUAt&E9EUM UEEԃ9EEvM<Euv ,99"ZtZfE9EEԋMUM UTE@UMT$ $%E]ԋMDEڍMЉD$Ẻ$E}̅t?E<$,1EEЉE]ԅMDE9EzUMUM '\E9E\ME\MEAE9EU+EEE"ED$4$c@)E$%%ljE̋EEԉ<$D$}̉<$GEËE9E}*EE|$)؉$Ẻ$EEmU9U}MT$ $!$}̉ED$0$%E;EM<$EƋE9E}EE|$)$M} mU9U}MT$ $#}̉EE$$E,MAA:AsED$ȃ$EE@EUD$$3#E}u 5u]E9E3EԋUE@UMT$ $"EE@UMT$ $"]ԉEeuԍUԍFEԋEY]ԃ)$)#u\$t$Ẻ$GED}̉<$DME9M}$EE|$)؉$Ẻ$mE9E}UD$$$"}̉E빃m;u}UMT$ $"EE@EUD$$!]ԉEE@MEL$$!EE@EUD$$!EE̋UM $U9U{M $fU]Éu}t;$$!\$$t؋u]}]Í&$ t@$P lj$i!t$É$_;P/@.hisBtoryB똾T  뼍'UWVS<+AED$\$$\ E؃ou9 EEܡ+]9~]1]EЉUU܍43vPt :$|8E+E9t Euɋ׉}E$>+u9UEMPt:unD$U$$,E8 95Eu볉E$|8(T$U$@$E8 E_Eԅt Eԉ$_ <[^_]ËE1ۉ|$D$U؉$ xU<$*E؉$EԅtUԉ$ <[^_]n Mԅɋt Uԉ$ E؉$H f렍&'UE]'U1ɉUE ]o UE}]uD$D$E$ tzED$|$$qE%=t'<$ E$ ؋u]}]Ëuċ]t&<$F 9 v붍S9wӉ$#E E\$<$D$% <$M EɍT0tT9sP: t} ȅt69Us1: u8)E ۍ&<$%9Us& B9Es€: u8tZ9]r1ۋE$ ED$D$$6 t̉+E\$1ۉ<$)Ɖt$ <$뫉<$1t&늍&UWVS|ED$D$E$zED$|$$gZuċ]tPEx<$Et E$ Et E$ |[^_]fS9w$%EEAE\$<$D$$ <$E!u9uE U1 Ѐ8 9v;} |9E t&9v~; u9fs { t*:tO$zEtE$xE9}~-S뤐E(Uˋ]t E$ E1ۉ$ CmU1-T]8HPt&UED$D$$ÐUHuƉ}=]Mu؋u]}]À8ttމ9„tȄtxv{4$E ]EСE}xU؋Eԉ$ 9E|}}+]ЍvEЅtAE؈UEvmtYEU:uUЉD$4$T$u҉= &}u;}Z1UЃ)ЅE~ʅtC1ۋUԈEU E;]tUE:uEЉT$4$D$Juk1dUЅҐt)U:`EЉT$4$D$E1ۉ=;&UEU ]U1ɉEU ] Uu]_ƋE$bE D$E$t64$<؋u]]É4$#UVSU E]Mu)9|6~% :u*1t&B:1u9u[^]Ít&[1^]Ív'U(eE1]]uu t3Ue3u\]u]É$ @9~ՍE)D$ EEET$\$$wEv= 'UWVS,EeU1EEE܉$] ۉE9E |M 1Ef;9E ~ZuƍED$ E؍U$)D$ED$aÍ@v;tOUtE$A u;u9E Ue3u),[^_]ûEEpE1ˍ&/ t&'U(Euu }}]$Ey]u}]Í&9|1ۅ rt&9~gEU)څtAT$|$ D$$gBv tōÃtG뭉$D$D$J )e'UWVS,EueU1EEE E!Å~-UED$\$$<9}@u;uUe3,[^_]ËE$ ttŋ]$,UT$ \$D$E$R@vtEׅt몐t&EE롋]$U\$T$ D$E$u C;E$ (ߋ]$U\$T$ D$E$Í@vt&t&'UVS]u $.t)t$ D$\$$Rt"t[^]D$D$$M مtFЍt&U]E]] }uD$$l~uEuD$4$Q~9t1]u}]:u~9U MD UM:D uΉSA8u9u말U]ˉuƉ}t8u6߉<$$1؉|$$؋u]}]É$<$EUD$hU1tt$$UE룍U]]u1}t&;~t3$_$\$$Ɖ]u}]ÍvC/MEƅuf^$\$<$D$u֋E EE؃$ U؉T$ËE$D$U$E$4$UĉÍD9EEE؉t$EEEĉ$J]ĉ4$]<EU9U]}}؀?/E ENUȋEL[^_]11EuŰEԍTỦЋUȃD$$3 EaEU9U։3fE̋UȍDẼD$$ EEE$Ẻ$W E/U\U~\]É'UWVS=u 5Xu E D$E$讫1ļ[^_]ÐU $T$荫@} ]t$} }} )ļ[^_]Dž`[ƃĔ<Dž\DžXT4\$T$ht:X\tmtXt ;Xt0TuXu9E t 9`)\DžX뚃\둅!l1 P$á$l\@E5@EED$lD$ D$D$$ 1@<Dž`{Dž`(v'UEtVD$ lD$ $)WD$ lD$ $];D$ lD$ $}D$ lD$0v $)D$ lD$0v $]D$ lD$0v $}ÐU‰1t/!<t]t&À:(tu]1Ã:tf뵍&'UVS ]dtxE\$D$$6t\u1ɉt;!$}Ee3uO,[^_]1t;111|t#t<\u1|u݉'UWVS$EUM7EEtGUt>։׃fML$D$$uE%=@tuˋEČ[^_]Ë$$|D$2>|/D뭋EMU|/҉Et1ҋMD uB$xE1u]+Ex $UD$/M$L$Et U/D$EE$EtED$$D$AgE%=@T$|/D:ExUtӉ$CuM $xE>'UxUT$D$$xE1%=@uɉɺÐUWVSEeU1ҋ] lt 8Nؿ \$$C1DžtEtC$dt1ɉtB;tuM;t(uv4$ft9uu4$Ue3;e[^_]Ðt&]tI1;u!EF$T4$JޅuС1tC뒐F$6͋l$#c$pQ=`5xt xtx 1DžtDž|EbUp$ GtlD$D$E$0WdT$D$ÍE$/ `Mȃ.n\U:.YZt.IR>4ؿ$l$hhD$Ƌl$$l$T$\$4$h0/h|$D2$ED$t$$`4$1 D$xDžt1Džtn$4( tEtbEM9MEv]}tt>(g&;u>?*‰}t}/uUe3|[^_]f[p\E9EtE fUȋ9UUr}Åz$Yt $ËM $@QE$E>$$E5E t }/#E }.t&M9M]{/t&Cփv?t&t@t !zM9ME tUȉD$EM$UD$t E$HfWU$ED}\E9EPE t%}.uU9U8E t My/%uUȋ!ƒ^ ЃEEȋEă[&E Mt \BߋEEUąE t /Mă-MDEċp]5}Et \S[QE'EẺ] EOM̃[M Uċ=h:H.[E EӋE <$~<$uu ɐu1Eċ8vEEȃh]$3$Ef!ExE]}}̅M̉M$?$0E9E] 9]MU 4$L$MT$uu1z=z ]]ېuă9EE$EċXE̅9M($$c 4$4$DM9.UU։Eu}&$|$UċMEŰQ#} ǃ:Gu]Gu+]ĉ$HECUD$Ẻ$D$DMDM$K]D$l@$D$@$Et@]$uEEÃ$EE$dUt$ T$ÃD$E$ M $ËE$UU\$$um}_tg1E_ ]ĉ}̋E$EUċ]E$$딋U1ɍF _M9ME ]{/g&:zUċr UEčUJU׉EN}C;uE u \}EM9MEEƒ[É߀}t1t+EM9EtE]9]wvEt>~(t&t3$T@D$utEU9EuE MUD$E $^u18voU$[$RP}[E$t&U$EE$Y$vK]9]wv9]E UM4$D$T$Ru1lEG]`U$E4]0MăM̃mŰ2u- f]tGE &u\ts~7v]̋]̃[uʋ=t :t.uЃ˃ŋEvZփ$_/$$ŰyUu]$GAE1M\$ $ UWVSÃ,EU؋UMԃ8(1U CE=C߃v ,[^_]$NE9EwE}؃E]萍t&U |UىT$ƍ@$Eu9u܉u9}؋Usx9}ss*U}UЋU ||EE9EU]؃U䐋ED$U$E؉uS9]؋ust$E $M܉؋U9]t$t$U ؉$MЋUt&9]s}9}Q?t&C}U |EE9E ]؋E9UU9]ru9]؋usUT$Eډ$E1uЉt$U ؉$M܋Uu1,[^_]ÉT$E $M܉Ui1Րt&}9}@t&E Uԋ2E؉D$E$U Uԅ2]UT$E $M܋UԋEf1GED$U $M܋UԋE<1'U}} Euu]EtAt=<$4$M]M uE}]&]u}]Í&'U]ډu19t)𢢛D$$u)؋]u]Ðt&UWVS,U܍PUP҈UU11EUUT8}UTt.uU| ]uًtWE辠E&t7U8uEU$D$T$uՋE<uFtM܅tU܉E,[^_]EE1EEafUWVS|EU;MEU E MЃUċU EȉUMЋEME9EEvUEȅt MЀ9(8?N*tS]ągU9EE9ExU9UE E8/M9M]E t }.M9΃?*‰LM Mt }/MȅEπ}t t5>( t(EvtfEE9EEv Mt&}t t >(;u>?*‰}t}/y|[^_]Ã[L\E9EЍvtE U9UUr}؉ޅlE9띐t&ދDX 4EjE t }/XE 4}.f(U9U6My/t&Fփv?t&t@t !U9UE tD$ML$EЉ$MUD |[^_]]ڋDX$wuE9EE t(}.u"U9UoE vt My/Y]EۈEUE̋UE&EU؃ރE1u؉봋M9MwE9EsEỦEUŰM+MUԉMU91)U'UWVEU} EE҉։Eu9ȉ^_]Ðt&9ƒEt U+EME ‹EUMEEMM uщNjE9щƉUro9t^1yEt2ƋE^9w*U9Us"f11G&1uf1$EM9vO1 UWV0UEu} EEEUu}u9UEfM9MvuЉ}fEЋUԃ0^_]ÍvEE U+E܋}uEEM ‹EMUUM ЋUMuU9U;UM)щMM܉EMM ‹ẺUENEtEUEt&1ufE9EwU9UsUMUЉMME+EMEM9d)UZU]Ít&'UWVS^%HSE)E}Ut+1ƍED$E D$E$9}u߃[^_]Ë$ÐUSPPt Ћu[]US[ÌG蠾Y[I have no name!rbashBASH_ENVi686-redhat-linux-gnuGNU bash, version %s-(%s) GNU long options: --%s Shell options: -%s or -o option run_wordexp--wordexp0 0%u %u run_one_command-cFUNCNAMEBASH_SOURCEBASH_LINENOmain%s: is a directoryPOSIXLY_CORRECTPOSIX_PEDANTIC\s-\v\$ > ~/.bashrc%s: invalid option%c%c: invalid option??host??emacsEMACSdumbPS1PS2/etc/profile~/.profile~/.bash_profile~/.bash_logindebuggerdump-po-stringsdump-stringshelpnoeditingnoprofilenorcposixprotectedrcfilerpm-requiresUsage: %s [GNU long option] [option] ... %s [GNU long option] [option] script-file ... -irsD or -c command or -O shopt_option (invocation only) Type `%s -c "help set"' for more information about shell options. Type `%s -c help' for more information about shell builtin commands. Use the `bashbug' command to report bugs. /usr/local/share/bashdb/bashdb-main.inc%s: cannot execute binary file%s: option requires an argument\KKKKKKKKKKkKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKtimed out waiting for input: auto-logout PROMPT_COMMANDeterm/%s TMOUTreader_loopPIPESTATUS ; readline stdin ;|&syntax error near `%s'syntax error%a %b %d%H:%M:%S%I:%M:%S%I:%M %p%H:%M%s.%dHOMEesacevalletexpected `)'=~-nUse "%s" to leave the shell. "$@"memory exhaustedthenelseeliffiforselectwhileuntildone[[-p&&||>><&>&;;<<-<<<&>>|newline44a|R}# }}}}}}}}}}}44444444}}}}}}}}}}J}}}- }}}}}}}}}}}}r}}} q }}}q}}q}}- }*}}}}}qRTr~P~PoY`V[[P\s\\\\$]?Ykii1jajjjjkfffgBgggg4hehhhh*iZii` a(a;anaaaaa/bBbUbhbbbbbbb c c3ccd}d PdReeS]]]^W^^3__`v`UU#VkVVVWWWWwWWWWX-XAXkXX~PXXXYvS~PSSSS~P T~P3T~PhTkNkZZ[~P~P)[8[G[~P~Pef^fTTTUIU\UoUYYY ZgZZZZ {();&| $   R$+RR.31!R+RCKWZ_rwRRRRRRRRRRRRRRRRR{bR)?RRjR)ReqRRRRRRRRRRRRRRRRRRRRRRRRRRRRR)RRRRRRRRR?RR"R)RRRRRRRRRRRRRRRRRRjj)RRRRRR,RR-6RRRR"RR)RRRjjjjjRRRRRRRRRRRjRR"R RRRRRRR RRRLRRRRRRRRRRRRRRR\RRRRRRhjjjRRRjRRRRRRRj!RR" RRRRR,*451+0/2.3  !"#$%&'()- $:..5589;,>1 3 1,A+,-,c22,,gh,k44244.,,x22|},l2,rijj2z{,2,*+2,121,-+,-+++,-4533 !"#$&'()/0 !"#$&'()55/0   %*+,33%33 33" !"#$3&'()3,-/024  !"#$&'()+,-/024  !"#$&'(),/024  !"#$&'()/024  !"#$&'()/024  !"#$&'(),/024  !"#$&'()/024 !"#$&()/0<=@b10|PQ]^T9Uwy:~szRqV 48mnos;{>Bsss?Ckss NsOs11SWXs'( ghsYijZbs[11\demnogh_11xr}mno`  "!#$)   % & *,a+- A l mno s   s DEFGHIJKLMzzz%&Zzz'*,-0:41/65789|jzzzz  "# %+(.uvzz}~zxwyz{iktzzzzzzz[z !$ YU)zzzzzzzzzzzSRzzVmnl_zzzzEFzzzz23TPXopqrsOe`Mg;z<GzHQWzzzzfNz=>zzCDIJ\zhabzzzzz^cdAB]?@KL  677778899999999999999999999999999999:::;;<<====>>>>>>>>>>>????????@@@@AAAAAABBBCCCDDEFFFGHIJJJKKLLLLMMNNOPPQQQRRRRRRSSTTTUUVVVWWWWWXXXXXXYYZZRRRRRRRRRZRRRRR4RRf^RSRRC !c"#$%&'()*+,-.56tufp7/v23syntax error near unexpected token `%s'syntax error: unexpected end of fileunexpected EOF while looking for matching `%c'unexpected EOF while looking for `]]'syntax error in conditional expression: unexpected token `%s'syntax error in conditional expressionunexpected EOF while looking for matching `)'unexpected token `%s', expected `)'unexpected argument `%s' to conditional unary operatorunexpected argument to conditional unary operatorunexpected token `%s', conditional binary operator expectedconditional binary operator expectedunexpected argument `%s' to conditional binary operatorunexpected argument to conditional binary operatorunexpected token `%c' in conditional commandunexpected token `%s' in conditional commandunexpected token %d in conditional command:~/dev/tty`%s': not a valid identifierOLDPWDgetcwd: cannot access parent directories%s(%s) clean_simple_commandexecutablesyntax error: `;' unexpectedsyntax error: `((%s))'make_redirection: redirection instruction `%d' out of rangemake_here_document: bad instruction type %dsyntax error: arithmetic expression requiredabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZЊPPPPPPЊ܊ЊPPPP( %u! ) && || [[ case %s in select %s in for %s in >> %s<<%s%s <<< %s%d<&%d%d>&%d%d<&%s%d>&%s%d<&%d-%d>&%d-%d<&%s-%d>&%s-%d>&-<> %s>|%stime -p for (( | if then else %cfunction %s () { } { print_command() do PS4(( )) '' ]] case %s in ''%s%s=(%s) cprintf: `%c': invalid format characterprint_command: bad connector `%d'͘"gNњۚ™5PiםK,mОY*dispose_commandƱqƱΰVF ΰcannot duplicate fd %d to fd %dcannot redirect standard input from /dev/null: %s%s: restricted: cannot specify `/' in command namesTIMEFORMAT: `%c': invalid format character%s: %s: bad interpreterELF%s: %s: bad ELF interpreter/dev/nulleval_builtinbuiltin_envreturn_temp_envexecute_cond_node%s: readonly functionfunction_callingsimple-commandbgfgauto_resumeexactsubstringsaved redirectssaved_redirects%s: command not foundloop_redirectionsexecute_commandreal %2R user %2U sys %2S real %3lR user %3lU sys %3lSPS3#? LINESCOLUMNS%*d%s%spipe errorpipe-file-descriptorsexecute_connectionexecute-shell-function;Mld :pop_var_context: head of shell_variables not a function contextpop_var_context: no global_variables contextpop_scope: head of shell_variables not a temporary environment scopeall_local_variables: no function context at current scopemake_local_variable: no function context at current scopeshell level (%d) too high, resetting to 1error importing function definition for `%s'IFSBASH_ARGVBASH_ARGC_=OPTERRignorespaceerasedupsignoredupsignorebothHISTFILE/dev/urandom%s=PPIDshell-initSHLVLOPTIND() {/usr/local/bin:/bin:/usr/bin+ i686HOSTTYPEOSTYPEMACHTYPEHOSTNAME60060MAILCHECKBASHBASH_VERSIONBASH_VERSINFOBASH_EXECUTION_STRING~/.sh_history~/.bash_historyIGNOREEOFignoreeofHISTCONTROLHISTIGNOREEUIDSECONDSBASH_COMMANDBASH_SUBSHELLRANDOMHISTCMDCOMP_WORDBREAKSDIRSTACKGROUPSGLOBIGNOREHISTFILESIZEHISTSIZEHISTTIMEFORMATHOSTFILELANGLC_ALLLC_COLLATELC_CTYPELC_MESSAGESLC_NUMERICLC_TIMEMAILMAILPATHTERMCAPTERMINFOTEXTDOMAINTEXTDOMAINDIRTZhistchars_t`b#`___1bbaaa;aa(null)last command: %s Aborting...%s: %s: %d%s: line %s: %s:%s%d: %s: warning: %s: readonly variable%s: unbound variablebash-maintainers@gnu.orgunknown command errorbad command typebad connectorbad jump3 *3 ;3 I3 jjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjsyntax error in expressionrecursion stack underflowinvalid arithmetic basevalue too great for base*/%+-&^|missing `)'exponent less than 0division by 0expression expectedbug: bad expassign token%s%s%s: %s (error token is "%s")expression recursion level exceededsyntax error: invalid arithmetic operatorsyntax error: operand expectedidentifier expected after pre-increment or pre-decrement`:' expected for conditional expressionattempted assignment to non-variable݊ Signal %d[%d]%c |%5ldDoneStoppedStopped(%s)RunningDone(%d)Exit %dUnknown status%*s(core dumped) & (wd: %s) %s: line %d: (core dumped)(wd now: %s) notify_of_job_statusSIGCHLD trap[%d] %ld [%ld: %d] tcsetattrno job control in this shell%s: job has terminated- [%d]%s (wd: %s)job-working-directorystart_pipeline: pgrp pipeforkchild setpgid (%ld to %ld)describe_pid: %ld: no such pidinitialize_job_control: getpgrp failedinitialize_job_control: setpgiddeleting stopped job %d with process group %ldwait_for: No record of process %ld%s: job %d already in backgroundwait_for_job: job %d is stoppedwait: pid %ld is not a child of this shelladd_process: pid %5ld (%s) marked as still aliveforked pid %d appears in running job %dQ::::::::VQ:::::::::::::::::::VQ::::::::::::::::::::::::::Va6dgadegagagaidgasegagaegaga)e)e)e)e)e)e)e)e)e)egagagagagabKcgagagagagagagagagagagagagagagagagagagagagagagagagagacgagagagagagagagagagagagagagagagagagagagagagagagagagagagagagagab(&C((((((((J(((((((((((((((((Vcommand substitution$[$(#%:-=?+/}%:=+/%s: substring expression < 0%s: bad substitution%s: parameter null or not set>(<(process substitutionno match: %scannot make pipe for command substitutioncannot make child for command substitutioncommand_substitute: cannot duplicate pipe as fd 1%s: cannot assign list to array memberbad substitution: no closing `%s' in %s$%s: cannot assign in this waycannot make pipe for process substitutioncannot make child for process substitutioncannot duplicate named pipe %s as fd %dbad substitution: no closing "`" in %sYou have mail in $_You have new mail in $_The mail in %s has been read interrupt trapreturn traperror trapdebug trapinvalid signal numbertrap_handler: bad signal %dSIGexit trapEXITSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGABRTSIGBUSSIGFPESIGKILLSIGUSR1SIGSEGVSIGUSR2SIGPIPESIGALRMSIGTERMSIGSTKFLTSIGCHLDSIGCONTSIGSTOPSIGTSTPSIGTTINSIGTTOUSIGURGSIGXCPUSIGXFSZSIGVTALRMSIGPROFSIGWINCHSIGIOSIGPWRSIGSYSSIGJUNK(32)SIGJUNK(33)SIGRTMINSIGRTMIN+1SIGRTMIN+2SIGRTMIN+3SIGRTMIN+4SIGRTMIN+5SIGRTMIN+6SIGRTMIN+7SIGRTMIN+8SIGRTMIN+9SIGRTMIN+10SIGRTMIN+11SIGRTMIN+12SIGRTMIN+13SIGRTMIN+14SIGRTMIN+15SIGRTMAX-14SIGRTMAX-13SIGRTMAX-12SIGRTMAX-11SIGRTMAX-10SIGRTMAX-9SIGRTMAX-8SIGRTMAX-7SIGRTMAX-6SIGRTMAX-5SIGRTMAX-4SIGRTMAX-3SIGRTMAX-2SIGRTMAX-1SIGRTMAXDEBUGRETURNrun_pending_traps: bad value in trap_list[%d]: %prun_pending_traps: signal handler is SIG_DFL, resending %d (%s) to myselfcannot allocate new file descriptor for bash input from fd %dsave_bash_input: buffer already exists for new fd %dppp+"Q+k?QnY>(%s: integer expression expectedargument expected%s: unary operator expected%s: binary operator expected`)' expected`)' expected, found %smissing `]'too many arguments%s.%d(%d)-%s%s.%d(%d)GNU bash, version %s (%s) 3.2releaseCopyright (C) 2005 Free Software Foundation, Inc. @(#)Bash version 3.2.25(1) release GNU ;|&( ;|&()'()'%s[%s: %s[%s]: %sarray assignbad array subscript%s: cannot assign to non-numeric index%s%s%s500%s: cannot create: %s%s: first non-whitespace character is not `"'bash_execute_unix_command: cannot find keymap for commandfc -e "${VISUAL:-${EDITOR:-emacs}}"fc -e "${VISUAL:-${EDITOR:-vi}}"no closing `%c' in %s%s: missing colon separatorbash_execute_unix_command$include hostname_completion_file/etc/hosts;|&{(`()<>;&| %s %dC-xC-efc -e vi "'$@Bashshell-expand-linehistory-expand-linemagic-spacehistory-and-alias-expand-lineinsert-last-argumentoperate-and-get-nextdisplay-shell-versionedit-and-execute-commandcomplete-into-bracescomplete-filenamepossible-filename-completionscomplete-usernamepossible-username-completionscomplete-hostnamepossible-hostname-completionscomplete-variablepossible-variable-completionscomplete-commandpossible-command-completionsglob-complete-wordglob-expand-wordglob-list-expansionsdynamic-complete-history'" \"'@<>=;|&()#$`?*[!:{#comment-begincompletion-ignore-casesymlink-hookFIGNORE "'@><=;|&(: "'><=;|&(:N N POSIX"" /usr/share/locale#: %s:%d msgid %s%s msgstr "" redirection error: cannot duplicate fd%s: cannot overwrite existing file%s: restricted: cannot redirect outputcannot create temp file for here document: %ssh-thdfile descriptor out of range%s: ambiguous redirect/dev/tcp/*/*/dev/udp/*/*" " " " 0 0   0  " " "     COMP_LINECOMP_POINTCOMP_WORDSCOMP_CWORDCOMPREPLYcompletion: function `%s' not foundprogcomp_insert: %s: NULL COMPSPECxrealloc: cannot reallocate %lu bytes (%lu bytes allocated)xmalloc: cannot allocate %lu bytes (%lu bytes allocated)unaliasunalias [-a] name [name ...]breakbreak [n]continuecontinue [n]callercaller [EXPR]cdcd [-L|-P] [dir]pwdpwd [-LP]truefalsedeclaretypesetlocallocal name[=value] ...echo [-neE] [arg ...]enableeval [arg ...]getoptsgetopts optstring name [arg]exit [n]fg [job_spec]bg [job_spec ...]help [-s] [pattern ...]jobsdisownlet arg [arg ...]readreturn [n]unset [-f] [-v] [name ...]readonlyshiftshift [n]sourcesource filename [arguments]. filename [arguments]suspend [-f]testtest [expr][ arg... ]timestype [-afptP] name [name ...]ulimitumaskumask [-p] [-S] [mode]waitwait [n]time [-p] PIPELINE{ ... }{ COMMANDS ; }%JOB_SPEC [&](( ... ))(( expression ))[[ ... ]][[ expression ]]pushdpushd [dir | +N | -N] [-n]popdpopd [+N | -N] [-n]dirs [-clpv] [+N] [-N]shoptprintfcompgenReturn a successful result.Obsolete. See `declare'.Logout of a login shell.alias [-p] [name[=value] ... ]bind [-lpvsPVS] [-m keymap] [-f filename] [-q name] [-u name] [-r keyseq] [-x keyseq:shell-command] [keyseq:readline-function or readline-command]builtin [shell-builtin [arg ...]]command [-pVv] command [arg ...]declare [-afFirtx] [-p] [name[=value] ...]typeset [-afFirtx] [-p] name[=value] ...enable [-pnds] [-a] [-f filename] [name ...]exec [-cl] [-a name] file [redirection ...]fc [-e ename] [-nlr] [first] [last] or fc -s [pat=rep] [cmd]hash [-lr] [-p pathname] [-dt] [name ...]history [-c] [-d offset] [n] or history -awrn [filename] or history -ps arg [arg...]jobs [-lnprs] [jobspec ...] or jobs -x command [args]disown [-h] [-ar] [jobspec ...]kill [-s sigspec | -n signum | -sigspec] pid | jobspec ... or kill -l [sigspec]read [-ers] [-u fd] [-t timeout] [-p prompt] [-a array] [-n nchars] [-d delim] [name ...]set [--abefhkmnptuvxBCHP] [-o option] [arg ...]export [-nf] [name[=value] ...] or export -preadonly [-af] [name[=value] ...] or readonly -ptrap [-lp] [arg signal_spec ...]ulimit [-SHacdfilmnpqstuvx] [limit]for NAME [in WORDS ... ;] do COMMANDS; donefor (( exp1; exp2; exp3 )); do COMMANDS; doneselect NAME [in WORDS ... ;] do COMMANDS; donecase WORD in [PATTERN [| PATTERN]...) COMMANDS ;;]... esacif COMMANDS; then COMMANDS; [ elif COMMANDS; then COMMANDS; ]... [ else COMMANDS; ] fiwhile COMMANDS; do COMMANDS; doneuntil COMMANDS; do COMMANDS; donefunction NAME { COMMANDS ; } or NAME () { COMMANDS ; }variables - Some variable names and meaningsshopt [-pqsu] [-o long-option] optname [optname...]printf [-v var] format [arguments]complete [-abcdefgjksuv] [-pr] [-o option] [-A action] [-G globpat] [-W wordlist] [-P prefix] [-S suffix] [-X filterpat] [-F function] [-C command] [name ...]compgen [-abcdefgjksuv] [-o option] [-A action] [-G globpat] [-W wordlist] [-P prefix] [-S suffix] [-X filterpat] [-F function] [-C command] [word]`alias' with no arguments or with the -p option prints the list of aliases in the form alias NAME=VALUE on standard output. Otherwise, an alias is defined for each NAME whose VALUE is given. A trailing space in VALUE causes the next word to be checked for alias substitution when the alias is expanded. Alias returns true unless a NAME is given for which no alias has been defined.Remove NAMEs from the list of defined aliases. If the -a option is given, then remove all alias definitions.Bind a key sequence to a Readline function or a macro, or set a Readline variable. The non-option argument syntax is equivalent to that found in ~/.inputrc, but must be passed as a single argument: bind '"\C-x\C-r": re-read-init-file'. bind accepts the following options: -m keymap Use `keymap' as the keymap for the duration of this command. Acceptable keymap names are emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-move, vi-command, and vi-insert. -l List names of functions. -P List function names and bindings. -p List functions and bindings in a form that can be reused as input. -r keyseq Remove the binding for KEYSEQ. -x keyseq:shell-command Cause SHELL-COMMAND to be executed when KEYSEQ is entered. -f filename Read key bindings from FILENAME. -q function-name Query about which keys invoke the named function. -u function-name Unbind all keys which are bound to the named function. -V List variable names and values -v List variable names and values in a form that can be reused as input. -S List key sequences that invoke macros and their values -s List key sequences that invoke macros and their values in a form that can be reused as input.Exit from within a FOR, WHILE or UNTIL loop. If N is specified, break N levels.Resume the next iteration of the enclosing FOR, WHILE or UNTIL loop. If N is specified, resume at the N-th enclosing loop.Run a shell builtin. This is useful when you wish to rename a shell builtin to be a function, but need the functionality of the builtin within the function itself.Returns the context of the current subroutine call. Without EXPR, returns "$line $filename". With EXPR, returns "$line $subroutine $filename"; this extra information can be used to provide a stack trace. The value of EXPR indicates how many call frames to go back before the current one; the top frame is frame 0.Change the current directory to DIR. The variable $HOME is the default DIR. The variable CDPATH defines the search path for the directory containing DIR. Alternative directory names in CDPATH are separated by a colon (:). A null directory name is the same as the current directory, i.e. `.'. If DIR begins with a slash (/), then CDPATH is not used. If the directory is not found, and the shell option `cdable_vars' is set, then try the word as a variable name. If that variable has a value, then cd to the value of that variable. The -P option says to use the physical directory structure instead of following symbolic links; the -L option forces symbolic links to be followed.Print the current working directory. With the -P option, pwd prints the physical directory, without any symbolic links; the -L option makes pwd follow symbolic links.No effect; the command does nothing. A zero exit code is returned.Return an unsuccessful result.Runs COMMAND with ARGS ignoring shell functions. If you have a shell function called `ls', and you wish to call the command `ls', you can say "command ls". If the -p option is given, a default value is used for PATH that is guaranteed to find all of the standard utilities. If the -V or -v option is given, a string is printed describing COMMAND. The -V option produces a more verbose description.Declare variables and/or give them attributes. If no NAMEs are given, then display the values of variables instead. The -p option will display the attributes and values of each NAME. The flags are: -a to make NAMEs arrays (if supported) -f to select from among function names only -F to display function names (and line number and source file name if debugging) without definitions -i to make NAMEs have the `integer' attribute -r to make NAMEs readonly -t to make NAMEs have the `trace' attribute -x to make NAMEs export Variables with the integer attribute have arithmetic evaluation (see `let') done when the variable is assigned to. When displaying values of variables, -f displays a function's name and definition. The -F option restricts the display to function name only. Using `+' instead of `-' turns off the given attribute instead. When used in a function, makes NAMEs local, as with the `local' command.Create a local variable called NAME, and give it VALUE. LOCAL can only be used within a function; it makes the variable NAME have a visible scope restricted to that function and its children.Output the ARGs. If -n is specified, the trailing newline is suppressed. If the -e option is given, interpretation of the following backslash-escaped characters is turned on: \a alert (bell) \b backspace \c suppress trailing newline \E escape character \f form feed \n new line \r carriage return \t horizontal tab \v vertical tab \\ backslash \0nnn the character whose ASCII code is NNN (octal). NNN can be 0 to 3 octal digits You can explicitly turn off the interpretation of the above characters with the -E option.Enable and disable builtin shell commands. This allows you to use a disk command which has the same name as a shell builtin without specifying a full pathname. If -n is used, the NAMEs become disabled; otherwise NAMEs are enabled. For example, to use the `test' found in $PATH instead of the shell builtin version, type `enable -n test'. On systems supporting dynamic loading, the -f option may be used to load new builtins from the shared object FILENAME. The -d option will delete a builtin previously loaded with -f. If no non-option names are given, or the -p option is supplied, a list of builtins is printed. The -a option means to print every builtin with an indication of whether or not it is enabled. The -s option restricts the output to the POSIX.2 `special' builtins. The -n option displays a list of all disabled builtins.Read ARGs as input to the shell and execute the resulting command(s).Getopts is used by shell procedures to parse positional parameters. OPTSTRING contains the option letters to be recognized; if a letter is followed by a colon, the option is expected to have an argument, which should be separated from it by white space. Each time it is invoked, getopts will place the next option in the shell variable $name, initializing name if it does not exist, and the index of the next argument to be processed into the shell variable OPTIND. OPTIND is initialized to 1 each time the shell or a shell script is invoked. When an option requires an argument, getopts places that argument into the shell variable OPTARG. getopts reports errors in one of two ways. If the first character of OPTSTRING is a colon, getopts uses silent error reporting. In this mode, no error messages are printed. If an invalid option is seen, getopts places the option character found into OPTARG. If a required argument is not found, getopts places a ':' into NAME and sets OPTARG to the option character found. If getopts is not in silent mode, and an invalid option is seen, getopts places '?' into NAME and unsets OPTARG. If a required argument is not found, a '?' is placed in NAME, OPTARG is unset, and a diagnostic message is printed. If the shell variable OPTERR has the value 0, getopts disables the printing of error messages, even if the first character of OPTSTRING is not a colon. OPTERR has the value 1 by default. Getopts normally parses the positional parameters ($0 - $9), but if more arguments are given, they are parsed instead.Exec FILE, replacing this shell with the specified program. If FILE is not specified, the redirections take effect in this shell. If the first argument is `-l', then place a dash in the zeroth arg passed to FILE, as login does. If the `-c' option is supplied, FILE is executed with a null environment. The `-a' option means to make set argv[0] of the executed process to NAME. If the file cannot be executed and the shell is not interactive, then the shell exits, unless the shell option `execfail' is set.Exit the shell with a status of N. If N is omitted, the exit status is that of the last command executed.fc is used to list or edit and re-execute commands from the history list. FIRST and LAST can be numbers specifying the range, or FIRST can be a string, which means the most recent command beginning with that string. -e ENAME selects which editor to use. Default is FCEDIT, then EDITOR, then vi. -l means list lines instead of editing. -n means no line numbers listed. -r means reverse the order of the lines (making it newest listed first). With the `fc -s [pat=rep ...] [command]' format, the command is re-executed after the substitution OLD=NEW is performed. A useful alias to use with this is r='fc -s', so that typing `r cc' runs the last command beginning with `cc' and typing `r' re-executes the last command.Place JOB_SPEC in the foreground, and make it the current job. If JOB_SPEC is not present, the shell's notion of the current job is used.Place each JOB_SPEC in the background, as if it had been started with `&'. If JOB_SPEC is not present, the shell's notion of the current job is used.For each NAME, the full pathname of the command is determined and remembered. If the -p option is supplied, PATHNAME is used as the full pathname of NAME, and no path search is performed. The -r option causes the shell to forget all remembered locations. The -d option causes the shell to forget the remembered location of each NAME. If the -t option is supplied the full pathname to which each NAME corresponds is printed. If multiple NAME arguments are supplied with -t, the NAME is printed before the hashed full pathname. The -l option causes output to be displayed in a format that may be reused as input. If no arguments are given, information about remembered commands is displayed.Display helpful information about builtin commands. If PATTERN is specified, gives detailed help on all commands matching PATTERN, otherwise a list of the builtins is printed. The -s option restricts the output for each builtin command matching PATTERN to a short usage synopsis.Display the history list with line numbers. Lines listed with with a `*' have been modified. Argument of N says to list only the last N lines. The `-c' option causes the history list to be cleared by deleting all of the entries. The `-d' option deletes the history entry at offset OFFSET. The `-w' option writes out the current history to the history file; `-r' means to read the file and append the contents to the history list instead. `-a' means to append history lines from this session to the history file. Argument `-n' means to read all history lines not already read from the history file and append them to the history list. If FILENAME is given, then that is used as the history file else if $HISTFILE has a value, that is used, else ~/.bash_history. If the -s option is supplied, the non-option ARGs are appended to the history list as a single entry. The -p option means to perform history expansion on each ARG and display the result, without storing anything in the history list. If the $HISTTIMEFORMAT variable is set and not null, its value is used as a format string for strftime(3) to print the time stamp associated with each displayed history entry. No time stamps are printed otherwise.Lists the active jobs. The -l option lists process id's in addition to the normal information; the -p option lists process id's only. If -n is given, only processes that have changed status since the last notification are printed. JOBSPEC restricts output to that job. The -r and -s options restrict output to running and stopped jobs only, respectively. Without options, the status of all active jobs is printed. If -x is given, COMMAND is run after all job specifications that appear in ARGS have been replaced with the process ID of that job's process group leader.By default, removes each JOBSPEC argument from the table of active jobs. If the -h option is given, the job is not removed from the table, but is marked so that SIGHUP is not sent to the job if the shell receives a SIGHUP. The -a option, when JOBSPEC is not supplied, means to remove all jobs from the job table; the -r option means to remove only running jobs.Send the processes named by PID (or JOBSPEC) the signal SIGSPEC. If SIGSPEC is not present, then SIGTERM is assumed. An argument of `-l' lists the signal names; if arguments follow `-l' they are assumed to be signal numbers for which names should be listed. Kill is a shell builtin for two reasons: it allows job IDs to be used instead of process IDs, and, if you have reached the limit on processes that you can create, you don't have to start a process to kill another one.Each ARG is an arithmetic expression to be evaluated. Evaluation is done in fixed-width integers with no check for overflow, though division by 0 is trapped and flagged as an error. The following list of operators is grouped into levels of equal-precedence operators. The levels are listed in order of decreasing precedence. id++, id-- variable post-increment, post-decrement ++id, --id variable pre-increment, pre-decrement -, + unary minus, plus !, ~ logical and bitwise negation ** exponentiation *, /, % multiplication, division, remainder +, - addition, subtraction <<, >> left and right bitwise shifts <=, >=, <, > comparison ==, != equality, inequality & bitwise AND ^ bitwise XOR | bitwise OR && logical AND || logical OR expr ? expr : expr conditional operator =, *=, /=, %=, +=, -=, <<=, >>=, &=, ^=, |= assignment Shell variables are allowed as operands. The name of the variable is replaced by its value (coerced to a fixed-width integer) within an expression. The variable need not have its integer attribute turned on to be used in an expression. Operators are evaluated in order of precedence. Sub-expressions in parentheses are evaluated first and may override the precedence rules above. If the last ARG evaluates to 0, let returns 1; 0 is returned otherwise.One line is read from the standard input, or from file descriptor FD if the -u option is supplied, and the first word is assigned to the first NAME, the second word to the second NAME, and so on, with leftover words assigned to the last NAME. Only the characters found in $IFS are recognized as word delimiters. If no NAMEs are supplied, the line read is stored in the REPLY variable. If the -r option is given, this signifies `raw' input, and backslash escaping is disabled. The -d option causes read to continue until the first character of DELIM is read, rather than newline. If the -p option is supplied, the string PROMPT is output without a trailing newline before attempting to read. If -a is supplied, the words read are assigned to sequential indices of ARRAY, starting at zero. If -e is supplied and the shell is interactive, readline is used to obtain the line. If -n is supplied with a non-zero NCHARS argument, read returns after NCHARS characters have been read. The -s option causes input coming from a terminal to not be echoed. The -t option causes read to time out and return failure if a complete line of input is not read within TIMEOUT seconds. If the TMOUT variable is set, its value is the default timeout. The return code is zero, unless end-of-file is encountered, read times out, or an invalid file descriptor is supplied as the argument to -u.Causes a function to exit with the return value specified by N. If N is omitted, the return status is that of the last command. -a Mark variables which are modified or created for export. -b Notify of job termination immediately. -e Exit immediately if a command exits with a non-zero status. -f Disable file name generation (globbing). -h Remember the location of commands as they are looked up. -k All assignment arguments are placed in the environment for a command, not just those that precede the command name. -m Job control is enabled. -n Read commands but do not execute them. -o option-name Set the variable corresponding to option-name: allexport same as -a braceexpand same as -B emacs use an emacs-style line editing interface errexit same as -e errtrace same as -E functrace same as -T hashall same as -h histexpand same as -H history enable command history ignoreeof the shell will not exit upon reading EOF interactive-comments allow comments to appear in interactive commands keyword same as -k monitor same as -m noclobber same as -C noexec same as -n noglob same as -f nolog currently accepted but ignored notify same as -b nounset same as -u onecmd same as -t physical same as -P pipefail the return value of a pipeline is the status of the last command to exit with a non-zero status, or zero if no command exited with a non-zero status posix change the behavior of bash where the default operation differs from the 1003.2 standard to match the standard privileged same as -p verbose same as -v vi use a vi-style line editing interface xtrace same as -x -p Turned on whenever the real and effective user ids do not match. Disables processing of the $ENV file and importing of shell functions. Turning this option off causes the effective uid and gid to be set to the real uid and gid. -t Exit after reading and executing one command. -u Treat unset variables as an error when substituting. -v Print shell input lines as they are read. -x Print commands and their arguments as they are executed. -B the shell will perform brace expansion -C If set, disallow existing regular files to be overwritten by redirection of output. -E If set, the ERR trap is inherited by shell functions. -H Enable ! style history substitution. This flag is on by default when the shell is interactive. -P If set, do not follow symbolic links when executing commands such as cd which change the current directory. -T If set, the DEBUG trap is inherited by shell functions. - Assign any remaining arguments to the positional parameters. The -x and -v options are turned off. Using + rather than - causes these flags to be turned off. The flags can also be used upon invocation of the shell. The current set of flags may be found in $-. The remaining n ARGs are positional parameters and are assigned, in order, to $1, $2, .. $n. If no ARGs are given, all shell variables are printed.For each NAME, remove the corresponding variable or function. Given the `-v', unset will only act on variables. Given the `-f' flag, unset will only act on functions. With neither flag, unset first tries to unset a variable, and if that fails, then tries to unset a function. Some variables cannot be unset; also see readonly.NAMEs are marked for automatic export to the environment of subsequently executed commands. If the -f option is given, the NAMEs refer to functions. If no NAMEs are given, or if `-p' is given, a list of all names that are exported in this shell is printed. An argument of `-n' says to remove the export property from subsequent NAMEs. An argument of `--' disables further option processing.The given NAMEs are marked readonly and the values of these NAMEs may not be changed by subsequent assignment. If the -f option is given, then functions corresponding to the NAMEs are so marked. If no arguments are given, or if `-p' is given, a list of all readonly names is printed. The `-a' option means to treat each NAME as an array variable. An argument of `--' disables further option processing.The positional parameters from $N+1 ... are renamed to $1 ... If N is not given, it is assumed to be 1.Read and execute commands from FILENAME and return. The pathnames in $PATH are used to find the directory containing FILENAME. If any ARGUMENTS are supplied, they become the positional parameters when FILENAME is executed.Suspend the execution of this shell until it receives a SIGCONT signal. The `-f' if specified says not to complain about this being a login shell if it is; just suspend anyway.Exits with a status of 0 (true) or 1 (false) depending on the evaluation of EXPR. Expressions may be unary or binary. Unary expressions are often used to examine the status of a file. There are string operators as well, and numeric comparison operators. File operators: -a FILE True if file exists. -b FILE True if file is block special. -c FILE True if file is character special. -d FILE True if file is a directory. -e FILE True if file exists. -f FILE True if file exists and is a regular file. -g FILE True if file is set-group-id. -h FILE True if file is a symbolic link. -L FILE True if file is a symbolic link. -k FILE True if file has its `sticky' bit set. -p FILE True if file is a named pipe. -r FILE True if file is readable by you. -s FILE True if file exists and is not empty. -S FILE True if file is a socket. -t FD True if FD is opened on a terminal. -u FILE True if the file is set-user-id. -w FILE True if the file is writable by you. -x FILE True if the file is executable by you. -O FILE True if the file is effectively owned by you. -G FILE True if the file is effectively owned by your group. -N FILE True if the file has been modified since it was last read. FILE1 -nt FILE2 True if file1 is newer than file2 (according to modification date). FILE1 -ot FILE2 True if file1 is older than file2. FILE1 -ef FILE2 True if file1 is a hard link to file2. String operators: -z STRING True if string is empty. -n STRING STRING True if string is not empty. STRING1 = STRING2 True if the strings are equal. STRING1 != STRING2 True if the strings are not equal. STRING1 < STRING2 True if STRING1 sorts before STRING2 lexicographically. STRING1 > STRING2 True if STRING1 sorts after STRING2 lexicographically. Other operators: -o OPTION True if the shell option OPTION is enabled. ! EXPR True if expr is false. EXPR1 -a EXPR2 True if both expr1 AND expr2 are true. EXPR1 -o EXPR2 True if either expr1 OR expr2 is true. arg1 OP arg2 Arithmetic tests. OP is one of -eq, -ne, -lt, -le, -gt, or -ge. Arithmetic binary operators return true if ARG1 is equal, not-equal, less-than, less-than-or-equal, greater-than, or greater-than-or-equal than ARG2.This is a synonym for the "test" builtin, but the last argument must be a literal `]', to match the opening `['.Print the accumulated user and system times for processes run from the shell.The command ARG is to be read and executed when the shell receives signal(s) SIGNAL_SPEC. If ARG is absent (and a single SIGNAL_SPEC is supplied) or `-', each specified signal is reset to its original value. If ARG is the null string each SIGNAL_SPEC is ignored by the shell and by the commands it invokes. If a SIGNAL_SPEC is EXIT (0) the command ARG is executed on exit from the shell. If a SIGNAL_SPEC is DEBUG, ARG is executed after every simple command. If the`-p' option is supplied then the trap commands associated with each SIGNAL_SPEC are displayed. If no arguments are supplied or if only `-p' is given, trap prints the list of commands associated with each signal. Each SIGNAL_SPEC is either a signal name in or a signal number. Signal names are case insensitive and the SIG prefix is optional. `trap -l' prints a list of signal names and their corresponding numbers. Note that a signal can be sent to the shell with "kill -signal $$".For each NAME, indicate how it would be interpreted if used as a command name. If the -t option is used, `type' outputs a single word which is one of `alias', `keyword', `function', `builtin', `file' or `', if NAME is an alias, shell reserved word, shell function, shell builtin, disk file, or unfound, respectively. If the -p flag is used, `type' either returns the name of the disk file that would be executed, or nothing if `type -t NAME' would not return `file'. If the -a flag is used, `type' displays all of the places that contain an executable named `file'. This includes aliases, builtins, and functions, if and only if the -p flag is not also used. The -f flag suppresses shell function lookup. The -P flag forces a PATH search for each NAME, even if it is an alias, builtin, or function, and returns the name of the disk file that would be executed.Ulimit provides control over the resources available to processes started by the shell, on systems that allow such control. If an option is given, it is interpreted as follows: -S use the `soft' resource limit -H use the `hard' resource limit -a all current limits are reported -c the maximum size of core files created -d the maximum size of a process's data segment -e the maximum scheduling priority (`nice') -f the maximum size of files written by the shell and its children -i the maximum number of pending signals -l the maximum size a process may lock into memory -m the maximum resident set size (has no effect on Linux) -n the maximum number of open file descriptors -p the pipe buffer size -q the maximum number of bytes in POSIX message queues -r the maximum real-time scheduling priority -s the maximum stack size -t the maximum amount of cpu time in seconds -u the maximum number of user processes -v the size of virtual memory -x the maximum number of file locks If LIMIT is given, it is the new value of the specified resource; the special LIMIT values `soft', `hard', and `unlimited' stand for the current soft limit, the current hard limit, and no limit, respectively. Otherwise, the current value of the specified resource is printed. If no option is given, then -f is assumed. Values are in 1024-byte increments, except for -t, which is in seconds, -p, which is in increments of 512 bytes, and -u, which is an unscaled number of processes.The user file-creation mask is set to MODE. If MODE is omitted, or if `-S' is supplied, the current value of the mask is printed. The `-S' option makes the output symbolic; otherwise an octal number is output. If `-p' is supplied, and MODE is omitted, the output is in a form that may be used as input. If MODE begins with a digit, it is interpreted as an octal number, otherwise it is a symbolic mode string like that accepted by chmod(1).Wait for the specified process and report its termination status. If N is not given, all currently active child processes are waited for, and the return code is zero. N may be a process ID or a job specification; if a job spec is given, all processes in the job's pipeline are waited for.The `for' loop executes a sequence of commands for each member in a list of items. If `in WORDS ...;' is not present, then `in "$@"' is assumed. For each element in WORDS, NAME is set to that element, and the COMMANDS are executed.Equivalent to (( EXP1 )) while (( EXP2 )); do COMMANDS (( EXP3 )) done EXP1, EXP2, and EXP3 are arithmetic expressions. If any expression is omitted, it behaves as if it evaluates to 1.The WORDS are expanded, generating a list of words. The set of expanded words is printed on the standard error, each preceded by a number. If `in WORDS' is not present, `in "$@"' is assumed. The PS3 prompt is then displayed and a line read from the standard input. If the line consists of the number corresponding to one of the displayed words, then NAME is set to that word. If the line is empty, WORDS and the prompt are redisplayed. If EOF is read, the command completes. Any other value read causes NAME to be set to null. The line read is saved in the variable REPLY. COMMANDS are executed after each selection until a break command is executed.Execute PIPELINE and print a summary of the real time, user CPU time, and system CPU time spent executing PIPELINE when it terminates. The return status is the return status of PIPELINE. The `-p' option prints the timing summary in a slightly different format. This uses the value of the TIMEFORMAT variable as the output format.Selectively execute COMMANDS based upon WORD matching PATTERN. The `|' is used to separate multiple patterns.The `if COMMANDS' list is executed. If its exit status is zero, then the `then COMMANDS' list is executed. Otherwise, each `elif COMMANDS' list is executed in turn, and if its exit status is zero, the corresponding `then COMMANDS' list is executed and the if command completes. Otherwise, the `else COMMANDS' list is executed, if present. The exit status of the entire construct is the exit status of the last command executed, or zero if no condition tested true.Expand and execute COMMANDS as long as the final command in the `while' COMMANDS has an exit status of zero.Expand and execute COMMANDS as long as the final command in the `until' COMMANDS has an exit status which is not zero.Create a simple command invoked by NAME which runs COMMANDS. Arguments on the command line along with NAME are passed to the function as $0 .. $n.Run a set of commands in a group. This is one way to redirect an entire set of commands.Equivalent to the JOB_SPEC argument to the `fg' command. Resume a stopped or background job. JOB_SPEC can specify either a job name or a job number. Following JOB_SPEC with a `&' places the job in the background, as if the job specification had been supplied as an argument to `bg'.The EXPRESSION is evaluated according to the rules for arithmetic evaluation. Equivalent to "let EXPRESSION".Returns a status of 0 or 1 depending on the evaluation of the conditional expression EXPRESSION. Expressions are composed of the same primaries used by the `test' builtin, and may be combined using the following operators ( EXPRESSION ) Returns the value of EXPRESSION ! EXPRESSION True if EXPRESSION is false; else false EXPR1 && EXPR2 True if both EXPR1 and EXPR2 are true; else false EXPR1 || EXPR2 True if either EXPR1 or EXPR2 is true; else false When the `==' and `!=' operators are used, the string to the right of the operator is used as a pattern and pattern matching is performed. The && and || operators do not evaluate EXPR2 if EXPR1 is sufficient to determine the expression's value.BASH_VERSION Version information for this Bash. CDPATH A colon-separated list of directories to search for directries given as arguments to `cd'. GLOBIGNORE A colon-separated list of patterns describing filenames to be ignored by pathname expansion. HISTFILE The name of the file where your command history is stored. HISTFILESIZE The maximum number of lines this file can contain. HISTSIZE The maximum number of history lines that a running shell can access. HOME The complete pathname to your login directory. HOSTNAME The name of the current host. HOSTTYPE The type of CPU this version of Bash is running under. IGNOREEOF Controls the action of the shell on receipt of an EOF character as the sole input. If set, then the value of it is the number of EOF characters that can be seen in a row on an empty line before the shell will exit (default 10). When unset, EOF signifies the end of input. MACHTYPE A string describing the current system Bash is running on. MAILCHECK How often, in seconds, Bash checks for new mail. MAILPATH A colon-separated list of filenames which Bash checks for new mail. OSTYPE The version of Unix this version of Bash is running on. PATH A colon-separated list of directories to search when looking for commands. PROMPT_COMMAND A command to be executed before the printing of each primary prompt. PS1 The primary prompt string. PS2 The secondary prompt string. PWD The full pathname of the current directory. SHELLOPTS A colon-separated list of enabled shell options. TERM The name of the current terminal type. TIMEFORMAT The output format for timing statistics displayed by the `time' reserved word. auto_resume Non-null means a command word appearing on a line by itself is first looked for in the list of currently stopped jobs. If found there, that job is foregrounded. A value of `exact' means that the command word must exactly match a command in the list of stopped jobs. A value of `substring' means that the command word must match a substring of the job. Any other value means that the command must be a prefix of a stopped job. histchars Characters controlling history expansion and quick substitution. The first character is the history substitution character, usually `!'. The second is the `quick substitution' character, usually `^'. The third is the `history comment' character, usually `#'. HISTIGNORE A colon-separated list of patterns used to decide which commands should be saved on the history list. Adds a directory to the top of the directory stack, or rotates the stack, making the new top of the stack the current working directory. With no arguments, exchanges the top two directories. +N Rotates the stack so that the Nth directory (counting from the left of the list shown by `dirs', starting with zero) is at the top. -N Rotates the stack so that the Nth directory (counting from the right of the list shown by `dirs', starting with zero) is at the top. -n suppress the normal change of directory when adding directories to the stack, so only the stack is manipulated. dir adds DIR to the directory stack at the top, making it the new current working directory. You can see the directory stack with the `dirs' command.Removes entries from the directory stack. With no arguments, removes the top directory from the stack, and cd's to the new top directory. +N removes the Nth entry counting from the left of the list shown by `dirs', starting with zero. For example: `popd +0' removes the first directory, `popd +1' the second. -N removes the Nth entry counting from the right of the list shown by `dirs', starting with zero. For example: `popd -0' removes the last directory, `popd -1' the next to last. -n suppress the normal change of directory when removing directories from the stack, so only the stack is manipulated. You can see the directory stack with the `dirs' command.Display the list of currently remembered directories. Directories find their way onto the list with the `pushd' command; you can get back up through the list with the `popd' command. The -l flag specifies that `dirs' should not print shorthand versions of directories which are relative to your home directory. This means that `~/bin' might be displayed as `/homes/bfox/bin'. The -v flag causes `dirs' to print the directory stack with one entry per line, prepending the directory name with its position in the stack. The -p flag does the same thing, but the stack position is not prepended. The -c flag clears the directory stack by deleting all of the elements. +N displays the Nth entry counting from the left of the list shown by dirs when invoked without options, starting with zero. -N displays the Nth entry counting from the right of the list shown by dirs when invoked without options, starting with zero.Toggle the values of variables controlling optional behavior. The -s flag means to enable (set) each OPTNAME; the -u flag unsets each OPTNAME. The -q flag suppresses output; the exit status indicates whether each OPTNAME is set or unset. The -o option restricts the OPTNAMEs to those defined for use with `set -o'. With no options, or with the -p option, a list of all settable options is displayed, with an indication of whether or not each is set.printf formats and prints ARGUMENTS under control of the FORMAT. FORMAT is a character string which contains three types of objects: plain characters, which are simply copied to standard output, character escape sequences which are converted and copied to the standard output, and format specifications, each of which causes printing of the next successive argument. In addition to the standard printf(1) formats, %b means to expand backslash escape sequences in the corresponding argument, and %q means to quote the argument in a way that can be reused as shell input. If the -v option is supplied, the output is placed into the value of the shell variable VAR rather than being sent to the standard output.For each NAME, specify how arguments are to be completed. If the -p option is supplied, or if no options are supplied, existing completion specifications are printed in a way that allows them to be reused as input. The -r option removes a completion specification for each NAME, or, if no NAMEs are supplied, all completion specifications.Display the possible completions depending on the options. Intended to be used from within a shell function generating possible completions. If the optional WORD argument is supplied, matches against WORD are generated.\ 0^ ^ d e e Df g xj (k T lk k 4m T  %2d %sno other directory%s: invalid timeout specification%s: invalid file descriptor specification%d: invalid file descriptor: %sersa:d:n:p:t:u:read_builtinread error: %d: %sX X X TZ EZ X X X X X X X X Y X Y X Y Y cY X can only `return' from a function or sourced scriptfv%s: cannot unset%s: cannot unset: readonly %s%s: not an array variableSHELLOPTS%-15s %s set %co %s allexportbraceexpanderrexiterrtracefunctracehashallhistexpandinteractive-commentskeywordmonitornoclobbernoexecnoglobnolognotifynounsetonecmdphysicalpipefailprivilegedxtraceoffcannot simultaneously unset a function and a variable)declare -%s %s -%s afnp%s: not a function-rashift countfilename argument required%s: file not foundcannot suspendcannot suspend a login shellunknowntrap -- %s %d trap -- %s %s Y Y   Y Y Y Y Y Y Y Y Y Y Y 5 Y Y Y Y 5 5 5 %s is aliased to `%s' alias %s=%s %s is a shell keyword %s is a function %s is a shell builtin %s is %s %s is hashed (%s) -typeafptP-path-all; ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' 3 ' ' ' ' F ' ' ' ' ' ' ' ' ' ( ' ' '  (%s, -%c) (-%c) %-20s %16sunlimited%s: cannot get limit: %s`%c': bad commandhardsoft%s: cannot modify limit: %score file sizeblocksdata seg sizekbytesscheduling prioritypending signalsmax locked memorymax memory sizeopen filespipe size512 bytesPOSIX message queuesreal-time prioritystack sizecpu timesecondsmax user processesvirtual memoryfile lockscde fi lm np(2q <6rQsdtoxuv x agourwxu=%s,g=%s,o=%s Spoctal number -Sumask%s %04lo `%c': invalid symbolic mode operator`%c': invalid symbolic mode characterOPTARG%s: invalid shell option name-s-ushopt %s %s psuoqcdable_varscdspellcheckhashcheckwinsizecmdhistdotglobexecfailexpand_aliasesextdebugextglobextquotefailglobforce_fignoregnu_errfmthistappendhistreedithistverifyhostcompletehuponexitinteractive_commentslithistlogin_shellmailwarnno_empty_cmd_completionnocaseglobnocasematchnullglobprogcomppromptvarsrestricted_shellshift_verbosesourcepathxpg_echocannot set and unset shell options simultaneouslyɫ  ث  ӫ  Ϋ   L\4$3<DUMVh\doxztd\PT X P x\U%(p 6DkO$)missing hex digit for \xwarning: %s: %s#'-+ 0v:hjlLtzlld                                                          Ʈ     Ϯ Ԯ ٮ                                             5          -  Ժ     Ժ     ` 5      5   5 `%s': missing format character%s: illegal option -- %c %s: option requires an argument -- %c -r%s: invalid action namecomplete bashdefault-o %s dirnamesfilenamesnospaceplusdirs-a-b-d-f-g-j-k-varrayvar-A %s enabledhelptopicrunningsetoptsignalstopped-G%s %s -W-P-X-F-Cgroupserviceuserabcdefgjko:prsuvA:G:W:P:S:X:F:C:%s: no completion specificationwarning: -F option may not work as you expectwarning: -C option may not work as you expect      $         0   <    H T         ` f l r x             - R  F ^ d hw@cQ a4Pbc|  d@ efM  g@j=ksT  @u2 vBASH_REMATCH/dev/fd/err/dev/std%s: bad network path specificationsocketconnect%ldm%d.%03dssh_makepathsh_realpathTMPDIR/var/tmp/usr/tmpshtmp%s/%s-%luw+  f f f f f f f f f f f f f f f f f f f f f      f      f f f f f f f f f f f f f f f f   f   f f f f f f f f f f f f f f f f f f f f f f f f f f f     f  f f f f f f f f f f f f f f f f f f f f f f f f f f    T   p p p p p p p p p p p p p p p p p p p p p    e  p      p  p p p p p p p p p p p p p p   p   p p p p p p p p p p p p p p p p p p p p p p p p p p p     p  p p p p p p p p p p p p p p p p p p p p p p p p p p     / 6 = D K R              Y            b                                                     b -     -          E E E E E E E        -      w                       V     Z f r  w                    %s/cur%s/tmp%s/new%s/%s%s/invalid base0123456789ABCDEF0123456789abcdefOAOBOCODOHOF5.1 l|h^0%bB l|hwW^0bB l|h^0bB hl^$0ftFT;,%wbeWBE|_*\AaIiCcDdPpYyRrSsXx~&&abortaccept-linearrow-key-prefixbackward-bytebackward-charbackward-kill-linebackward-kill-wordbeginning-of-historybeginning-of-linecall-last-kbd-macrocapitalize-wordcharacter-searchcharacter-search-backwardclear-screencopy-backward-wordcopy-forward-wordcopy-region-as-killdelete-char-or-listdelete-horizontal-spacedigit-argumentdo-lowercase-versiondowncase-worddump-functionsdump-macrosdump-variablesemacs-editing-modeend-kbd-macroend-of-historyend-of-lineexchange-point-and-markforward-backward-delete-charforward-byteforward-charforward-search-historyhistory-search-backwardhistory-search-forwardinsert-commentinsert-completionskill-whole-linekill-regionmenu-completenext-historyoverwrite-modepossible-completionsprevious-historyquoted-insertre-read-init-fileredraw-current-linereverse-search-historyrevert-lineself-insertstart-kbd-macrotab-inserttranspose-charstranspose-wordstty-statusundouniversal-argumentunix-filename-ruboutunix-line-discardunix-word-ruboutupcase-wordyankyank-last-argyank-nth-argyank-popvi-append-eolvi-append-modevi-arg-digitvi-back-to-indentvi-bWordvi-bwordvi-change-casevi-change-charvi-change-tovi-char-searchvi-columnvi-completevi-deletevi-delete-tovi-eWordvi-editing-modevi-end-wordvi-eof-maybevi-ewordvi-fWordvi-fetch-historyvi-first-printvi-fwordvi-goto-markvi-insert-begvi-insertion-modevi-matchvi-movement-modevi-next-wordvi-overstrikevi-overstrike-deletevi-prev-wordvi-putvi-redovi-replacevi-ruboutvi-searchvi-search-againvi-set-markvi-substvi-tilde-expandvi-yank-argvi-yank-tonon-incremental-forward-search-historynon-incremental-reverse-search-historynon-incremental-forward-search-history-againnon-incremental-reverse-search-history-again') 'c 'pd +'X 9']  )s G'6 Z'4 'p_ m'| '0W '0< 'Pc '[ 'P[ 'e +` '0 (0 (0 )i )(j =(g U( d(pW y(pc ( (@ (p (x (< ( } (PW (W )j ")X /) \ <) (] S)j k)j )o )@ )4 P'5 )05 c'@4 ) ){ `- p -p - l -k )x )P )@| *t *P 0*e D* [*8 g*0v %-W s* = *Pt :-' *@l *m *) *p8 * *1 *`1 *2  +c +, ++ (+p, 5+, >+p\ L+pD [+_ h+`I z+`= +PO +@] +L +@Y +G +0\ +b +@K +p[ +0> +0y  ,R ,B %,M .,< 7,c H,I W,Q `,@ m,I {,? ,pE ,pa ,S ,B ,0B ,R ,\ ,PT ,A ,0J -b -@c "-0A .-0[ 7-a G-d S-X //--More-- "\'`@$><=;|&{(Display all %d possibilities? (y or n) readline: bad value %d for what_to_do in rl_complete nonereadline: %s: line %d: %s readline: %s $endif without matching $ifaudiblevisiblebell-stylecompletion-query-itemsisearch-terminatorskeymapset %s %s %s is set to `%s' "%s%s": "%s" %s%s outputs %s \C-%cblink-matching-parenprefer-visible-bell# %s (not bound) "%s": %s %s is not bound to any keys %s can be found on ... C-\M-unknown parser directiveno closing `"' in key bindingprefix-metaINPUTRC~/.inputrc/etc/inputrcterm=mode=Control-C-CTRL-Metaotherbind-tty-special-charsbyte-orientedconvert-metadisable-completionenable-keypadexpand-tildehistory-preserve-pointhorizontal-scroll-modeinput-metamark-directoriesmark-modified-linesmark-symlinked-directoriesmatch-hidden-filesmeta-flagoutput-metapage-completionsshow-all-if-ambiguousshow-all-if-unmodifiedvisible-statsemacs-standardemacs-metaemacs-ctlxvi-movevi-commandvi-insertendifincludeDELESCEscapeLFDNewlineRETReturnRuboutSPCSpaceTab$else found without matching $ifprint-completions-horizontallyF F F F F F F F                                          u `  K 6 !                  h _4lR3Xv4N \4l4P44x4x444 55h85K5U5a5g3\6dr5`5d5l2 N  2 +P 2 3   l5 l5@t5`|hL 5552 5 L  5` 566 6 6 6 6 #6*6 .6 46  M    # B @:\%oreadline: debug: insert_some_chars: count (%d) != col (%d) /-_=~.#$:readline: readline_callback_read_char() called with no handler! coli amxnkmMT@7DCclcrdceiimkDkHkIkdkhklkrkummmopcvbvs ;D ;1 p,;;;;|;t;H";@%;L(;(,8+;<.;01;,44;$ O 7;:; x=;@;C;PMT(arg: %d) X%lu() <>;&|$"'`no previous substitutionunknown expansion errorevent not foundbad word specifiersubstitution failedunrecognized history modifier:$*%^ = ;&()|<>ώ   s ݎ                                                                               8      ~ ~                                                              h h h h h h h h   h h h h h h h h h h h h h h h h h h h   h h h h h h h h h h h h h h h h h h h h h h h h h h    ?*+@!asciiwordalnumNULSOHSTXETXEOTENQACKalertBSbackspaceHTLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusdashperiodfull-stopzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELascii?*+@!alnumalphablankcntrlgraphlowerpunctupperxdigitNULSOHSTXETXEOTENQalertBSbackspaceHTVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusdashperiodfull-stopzerotwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracket         = =                        \ u        6 O f           u u                    ; ; :KLL LLb+LLQ,$LL *LDN 0L;X7Dxp7y7y7z7Tz7z7T{8t{08|L8d|d8d888889t09P9t|9ĝ9999::Ģ4:ԢL:d:4|:T::::T: ;(;D@;tX;Ħx;d;t;ħ;;;<4<tP<dl<ԫ<<T<<Ԭ<D=,=TL=l====$=>$$>D>D\>|>d>>>>??dF>F>F?GdA(GA@GAdGA|GBG$BGBGDGDGFHDF4HFPHFhHFH$GHGHGHTKHDLIL4IRTItTtITIUIWIWIYJY$JT[DJ[dJ4\Jt]J]J]JD^J^ K_,K_LK_hKaK4bKTbKbKbKdLd,LeLLdelLeLdoLoLoL$pLpMtq0MtsPMshMtMuMwMxM4yNT N@N`NTNģNNԪN$ O,OLOpOO$O4ODOdOP P8PPPhPdPtPPԿPP4Q Q8QPQhQQQ4QQQ Rd(RDRd`RxRRRRRRS,SHS`SxSS$STSSdST0TdPThTTdTTDTU(UdHU`U$|UUUDUU$V4,VDDVt`VxVVVVVVdW4WTWtWdWWWWWtX4XdTXlXX$XXX Y(YDYDdYt|YdYYtYYZT4ZTZtZDZZZDZ4Z[$0[4H[T`[$[t[[t[[t\,\DH\h\\\$\t\\$]t0]L]l]T]]]4]]^<^\^D |^ ^ ^ ^ ^D _0_TP_p__d___4`4`<`$T`t`$``4```Ta,aDa\aDtataa4aab( b(8b+Xb+tb,b.bt.b.b/cd04c0Tc1tcT1c1ct2c6c7d$8,d9Ddt9`d:d:d;d;d;d<e4<e<e>e>e> f?(f$?@fD?Xf@pfD@f@f@fAf4BfBgC4gCLgChgdDg4EgDEgEgFhDGhG4hMThRthZhDZhdZhZhZi[i[ w$?@w?`wdDwDwEw4GwHxDH xHPd@p4BFS]^`0aH4a`Dceeggg Dh,hLDilTj$kl$mmtn4TpXtsxsutvvtwx z@${XxԅD T@`4Td$ԬHlĶ(| ]AB I8LAB PP AB hp6AB bAG I AB LAB AB D`RAB  AB AG,AAB DHRAB DdpAB FAB DOAB C@AB ;AB BF(D  F AB D$CAB < AB DXSAB Sx@AB DAB  AG FB   AH 0(FB  `'FB $AH <'FB T#AB l-IB @fFB AG `LB Ap'GB !AG MAB E  AB 8 AB PKAB h AB E.AB AB D]AB F@AB DAB AkAB D002AB Hp2AB `PAB x+AB 0eAB F AB FEE@oAB F AB Ip AB D0` AB FPP AB Fp@@AG BIAB F@ ;AB D  AB I`A7AB AAB F$pGMAB D@GMAB D\HAB t HAB @HAB D@IAB DIAB FKAB KQAG @LAB E4M&AB AVTl,AB Ft nFAB pnAB Fpo-AB o}AB  p@AB A`pNAB  p9AB E 0 qAB FIFT rfAB Dp sAB  sAB FL tAD E puAB R vAB FFF @w>AB D( w#AB @ w<AB X w7AB Dt 0x(AB  `xaAB D xAB O ySAB  @zAB FI zAB E {tAB D < 0|AB FFF` }AB F }SAB D ~wAB E ~AB D 0AB PF AB IF AB FE8 AB EX ]AB Dt ?AB D ;AB  UAB D `SAB P 8AB D 0AB   0FAB MEE< AG T AG  l NAB FFF jAB IFF *AB  ZAB LFE AB 0AB  PHAB FFF DAB FFFhPMAB  AB IFF0KAB RAB  AB LFF EAB MFFqAB F<AB C\eAB I|$AB D06AB pNAB BFAB  HAB ACF 0AG $P AG <`AB TbAB lAB F0AB  HAB Ap.AB D3AB D AB 1AB D,@1AB DHlAB AdGAB A@bAB FHAB C=AG DfAB HHPyAB FФkAB A8@)AB PpAB ^p`AB E AB FMAB D0|AB EiAB FI  iAB FI ,?AB IFFPЭ.AB h5AB @YAG mAB D\AB EpyAB ENAB D@AB FI0P:AB DLAB Dh[FB 'AE @AB F'AB A MAB EpFAB NE&AB D0 AB IPSAB h #AB P'AB DAB AC@AB DAB AD/AB &AB O00#AB H`AB AGh@AB FE aAB IAB CAB F`AB F AB IFF ,gAB ACCP PAB CppAB E 0IAB ACFUAB C$AB BF AB ACI qAB E8pAB PAB hAB AB AB .AB 'AD @AB `AG pEAB KF0 AB H-AB Ad.AB A0 AB @EAB EAB  AB &AB   AB 0AB F0?AB H iAB `xAB TAB 0?AB DpFAB DAB D`^AB D'AB  GB 8AH P AH h0.AD DD`vAB D/AD CAB `~AB D AB 'AB  0#AB 8`AB P%AB hAB EpFAB FB  AB EAB F9AB IAB P0PnAB FP]AB Ip qAB FlAB EYAB EpBAB J"AB AB D$lAB AFDoAB FHd` 4AB D AB EP!%AB D! AG !AD !/AB D! AG  ! AG 8! AG P" AG h"AD  "AB F $AB FFF$#AB $ AB F&UAB F `'XAB D8 'AB DT P( AB l `(AB F 0*AB  P*yAB D *-AB D +AB F -$AB  !-MAB IEE8!@.=AD P!.AB OFp! 0AB FL ! 1AB JEE!2yAB D!`3uAB D!3AB FI "4&AB $"4AB FD"5SAB D `" 6AB FFF"6eAB D"@7AB D"7AB F"9YAB L":`AB FF#p:$AB 4#:DAB DP#:NAB h#@;YAB #;AB F#<AB FF#@=5AB #= AB #=AB $=AB E($>NAB FFH$>HAB `$ ?AB D|$?VAB E$0@AB D$@FAB D$ AAB D$AUAB AF%CAB E0%D"AB H%EbAB MFh%EGAB %E|AB Q%PF,AB %FOAB MI%F=AB D%GEAB FF&`GEAB FF4&G=AB L&GXAB d&PH? AB F&TdAB E&UPAB D &PU AB FFF&`VAB FI'WAB F$'YAB CD'P[AB Fd'\"AB |'] AB D'0]kAB AF']AB PF'`^DAD E'^QAB AF(_6AB FI8(PbnAB EX(b#AB p(bUAB AF(Pc7AD (cAB D(d_AD IF(dAB (eiAB L)fAB D8)gAB FEX) hjAB Dt)hMAG )hTAD )@ibAG )i3AB )i3AB )0j<AB *pj.AB *j!DE 4*jAB L*`k#AB Ah*kAB AF*@lAB B*n AB F*x)AB *yAB F+{^AB D+P|AB F<+ }4AB F\+`~bAB F|+~rAB F+PAB F+@~AB F+KAB F+KAB F,`KAB F<,AB F\,@AB E|,ЂkAB F,@AB H,0CHB ,AB ,pXJB A-ЉAB AF (-`AB KFFL-PFB d-AB |-*FB -@GB -`"GB -AB BC- AB AC.!AB A .!SE 8.4KD P.PSHB Al.9GB .AB .%AG .09AB A.p AG .AB /AB /p.AB 0/DAB H/DAB `/@AB BI/AB I /AB ACI/P AD /`AG /pAB D00AB  (0AB ACIL0AB d0AB O 0PAB ACI0@SAB A0WAB 0AB C0AB I1lAB F<1`?AB J\1AH t15AB 1=AB AD1@+LB 1pAB H1FAB D2PAB  2AB LKF<2ЭAB T2`7AB  l2AB IFI2AB BI26AB I2гwAB D2PvAB D3дPAB  3 >AB 83`AB BIX3AB p3~AB D3rAB 3AB D3&AB 30AB F3AB I4AB E84AD P4BAB h40eAB I4AB I4CAB I4AB I4 AB I5%AB D$5"AB D@50%AB D\5`AB I|5`SAB 54AB 5AB 5  FB 5@AB I5=AD 6 JAD A06pCAD CL6AD d6 AG |66AB A6 cAB E6AB E 6@PAB FFF6AB AC7 dAB A87AB D T7 AB HEEx7 AB AI7AB AD 7JAB FRE7PAB F7;AB AG800AB D88`>AB FX8CAB Fx8AB F8AAB F8`AB C 8AB FEE89AB HE9HAB F<9` AB BF\9AB F|9@*AB A9pAB D9AB F9 AB 9@OAB L :AB FFF0:pAB FP:P_AB Ip: AB F : AB UFH:`AB F:p=AD  :jAB ACF; AB F0; AB EP;AB BFp;DAB I;OAB L;0OAB L;AB F;`AB AG<AG (< 0AB AGH<PAD `<pAG x<"AG <AB I<&'AB <'/AG <@'/AG <p'AB AD=*AB F8=-AB FX=/AB AGx=3AB F=`79AB F=<AB F=P@AB AG=`BAB AJ>aa AB I8>jAB IX>0AB Fx>AG >AG > AG >@AB FF>0hAB A>AD ?GAD ,?\AD OL?pCAB Ah?gAB B ?0AB HEE?0AB D?AB HE?XAB O @AB FEF,@gAB DH@0AB II h@AB FHE@AB F@p!AB D@mAB D@!AB @@%AB  ApAB FIF 8ApMAB FIF\AAD tA-AB DA AB A0\AB FA!AB DAAB FBpzAB E $BAB FFFHBAB FhBAB FIB@FAB FB?AB ABСAB EB`zAB AC}AB I C`6AB F@CYAB D\CAB F|CШAB C|AB PCp'AB CAB CAB CЩAB DAB ,DAB DD0AB \DP+AB DxDAG DAG DЬ1AB DAB AFDAG DЭAG E|AB NF0E`4AB DLEAB DhE`AB DEAB HEAG E>AB DEFB EcAD FpAB FI(FAB @F0AB XFPAB pFp&AB F>AB FAB IFAB FIF6AB FG)AB DGAB 4G/FB LGл+HB dG7HB |G@AB G`;AH IGAB DGpmAB DGBAB FFH0-AB D$H`KAB AB Y/ AB FF Y`0 2AB 8Y0 AB DTYP1 AB FFtYP2 <AB Y2 AD Y2 AB FY@3 5AB Y3 KAB DY3 )AB CZ6 AG 0Z 6 AG HZ@6 _AB EhZ6 hAB DZ7 JAB AG Z`8 OAB FIFZ9 AB EZ: mAB F[@; wAB FI([= AB IH[`A DAB `[A AB x[A <AB [B 5AB [PB -AB [B AB F[ G bAB F\I LAB AG \J AG 8\K 1GB P\@K FAB FIp\K  AG \K  AG \K  AG \K AG \K  AG \K AG ]K  AG ]L AG 0]L  AG H] L AG `]0L  AG  x]@L AB LII]L AG ]L nAB PI]PM GAB D ]M cAB FFF^O AB ,^0O AB D^PO AB \^pO AB t^O AB ^O GAB ^P vAB D^P ?AB  ^P wAB NEI^@Q AB A _R |AB FII<_R AB DX_ S YAB Ix_S ,AB _S -AB _S lAB II_PT AB F_U 0AB D` ] KAG `p] [AB D8`] dAB DT`@^ . AB Ft`ph AB E`@k AB D`l aAB F`@o OAB F`p AB Eapq HAB Q0ar dAB FPa0u AB Fpaw nAB II ax AB FFFay "AD a@y AD a`y !AB Aby cAB MG bz AB 8b z \AB AG Xb{ JAB FFF|b{ AB Fb`| AB Fb| \AB DbP} AB Fbp AB Fcp CAB 0c KAB FIPc ZAB Fpcp AB Ec AB c ~AB Dcp AB Dcp @AB c pAB Dd AB D0d@ <AB Hd tAB B hd AB FEEd iAB FEd  AB Id0 AB dP AB dp AB AJe` gAB AC KAB BI u@ &AB IFEuC NAB AvD 4AB I8v@H AB E XvH AB FFE|vI AB F vJ AB FFIvK AB AvK *AB vK WAB Fw@P WAB E4wP 7AB APwP  AB FpwR AB FwV  FB wW )AB w@W 8AB wW ^AB FEwW AB Ixh AB 0xh ^AB Hxi BAB `x`i AB xxi `AD xi rAD x`j @AB xj AB xPk AB Fx0n AB Fy0p AB F8yp AB FXyq JAB Fxyr oAB Dypr HAB Dyr lAB Ay0s AB Fys CAB F z@v AB LK,zw %AB FLz{ ^AB dz`{ MAB Fz~ #AB z~ #AB z bAB Fz 9AB z TAB IK { AB ${@ AB BD{@ AB Ld{ AB H{ MAB V{0 AB BC{0 iAB F{ AB BF| .AB A | UAB ILED|P =AB Bd|  AB F| AB F|` AB A |@ AB FFE| KAB I}@ AB }` gAB FE<}Т AB FT\} AG t}P JB }p @AB } AB } cAB F}0 7AB A }p jAB ACF~ oAB  4~P AB ACCX~ yAB Jx~ KAB L~ xAB F ~p AB FFE~0 "LB ~` GB   AB IE,0 /AB A H` AB KEEl0 XAB  AB O@ AB AC wAB BFp AB II` $FB  AB T< -AB TP AB FLt0 AB C AB  0 AB ACFЀ AB  eAB F` AB F( RAB DD` AB D` AB E AB FI  AB  $AB Ё 9AB  +AB @ 8AB  8AB 0 {AB DL@ {AB Dh AB  TAD @ =AB F AB DԂ MAB BF` (FB  6AB $ AB < AB T AB l .AB D@ "AB p AB DP AB D؃0 AB D AB D AB D, EAB D  AB \0 EAB t AB F0 AB LR0 AB FIԄ uAB ` AB F HAB A( 3AB GD )AB F d@ AG IGG hAB @ gAB F KAB A܅ AB F AB I p AB FFF@ AB D\p UAB F | qAB IFEP /AB I >AB F AB  AB FIp "AB 0 ^AB FP @AB Dl@ 6AB D )AB D tAB Eć0 AB F jAB E DAG F$ AB FD AB Fd AD | .AB D0 )AB D` AB FԈ@  AB P AB F 4AB D(` AB @ AB F`0  AB x@ }AB AG gAB I0 [AB Љ AB E  AB F AB F0P qAB EP AB Ep` AB F FAB B@ &AB FIЊp ZAB FI AB F AB F 0P AB IFFT! AB Ft$ AB F `( AB FQF ) wAB I؋) AB FF`* hAB AG* 0FB 0+ AG H+ AG `+ AG x, ?AB , AB D- AB Č/ 5AB ܌ 0  AB 00 ,AB  `0 AB FIF0 4 'AB  HP4 AB IEEl`5 AB E 6 AB 6 LAB 08 AB E܍09 AB D : ~AB D: aAB F4< $AD L@< -AB dp< AB |< AB F`= AB BD0> RAB F܎? AB ? 4AB D? IAG (@@ ZAB @@ *HB X@ AB p@ ?AB 0A 'HB `A AB A AB ЏB AB 0B AB FB EAB D$@C kAB IEDC 4AB AFdC sAB FEpD 2AB DD cAB  E GAB АpE AB FG `AB D H dAB $`I AB EDI AB \I 2AB D x0J AB FFF@K AB E L AB ACFL AB M nAG BM \AB F8PO AB FXQ mAB FxR dAB FFR AB FFS AB FFؒ T ,AD PT AB U zAB F(X AB EH@Y AB Fh0[ @AB Dp[ AB D0\ 7AB p\ 2AB Dԓ\ AB F@] AB F_ GAB ,@` AB KL` wAB dpa MAB |a ;AB Db AB Db ^AB DД@c HAB c tAB Dd HAB `d  AB 4pd AB DPe WAB Dl`e AB F0f ^AB Ef 1AB ĕf XAB ܕ0g :AB Dpg AB  h AB HEE4h [AB Li AB BFlj AB Jj AB J0k AD K̖k 0AB  l 0AB Pl 8AB Al AB IE8m AB AFX`n ;AB Atn IAB Dn AB ADp AD ȗ p AD @p #AB App eAG Ap HB 0q MAB ACPq ;AD h0r AB @r BAB ACr !AD  s hAB FFEܘ0t AB Gt  AB u 'AB (0u 'AB @`u 9AB Xu eAB pv ~AB Dv RAB Hz AAB ę@{ <AB ܙ{ >AB E{ AB FЀ AB F <` AB HEE ` AB FFJ Є &AB IRE 9AB @ vAB Aܚ AB Cp tAB FH AB A8 AB FX AB GExЍ oAB AF@ AB F  AB F؛ SAB F AB DP AB F4@ AB LP AB d` vFB | `AB FI@ !AB Fp AB Fܜ hAB A 3AB DХ AB , "AB D HAG G`p AB Fp ;FB  AB Ч  AG ȝ ,FB  'LB @ hAB  >AB ( RAB @P AB D\ TAB t@ MAB E (AB  AB DȞ YAB AG YAB AG@ AB MH( AB BFH AB Ad0 =AB Fp JAB  `AB D AB AG؟ AJ @ JAB  AB FI( ZAB EH AB BCh AB  AB FI@ CAB AF QAB F AB F JAB P 8AB D4 QAB FT AG Et AB F nAB E` )AB ̡ )AB  rAD FFF@ #AB  p -AB 8 +AB P +AB h =AB F@ AB F` rAD SȢ dAB P "AB D 5AB D AB E8 [AB DT0 DAB Dp AB AC AB HEE AB Fԣ0 qAB I >AB D AB D, AB FL AB d AB | [FB  6AB ` +AB Ĥ FB ܤ@ FLB  3AB  6AB $ 9AB AFDP 7AB \ +AB t AB F KAB  NAB AD̥ AB F@ #AD p AB E$ $AB FD0 AB D` AB x <AB E0 2AB p mAB KIЦ AB  uAB D  AB E$@ YAB AGD AB Id@ PAB E AB L AB Fħ +AB ܧ LAB G! %AB  @! AB IUW 4! [AB IEEXP" QAB p$  AB $ 4AB % AB IP% AB ب%  AB & /AB D 0& AB $P& AB <p& AB T& /AB Dp& /AB D& AB ' mAB Fĩ' 1AB F( FAB D) AB  ) \AB 0)  AB H) SAB Dd) PAB D@* YAB FL* AD * AB BFت+ AB Dp, AD  , BAB $, AB QD- AB Td/ xAB LJ 0 AB HEI0  AB 0  AB ث0  AD  1 WAB FFF`1 IAB ,1 (AB FL2 AB Fl4 =AB @4 oAB D4 qAB D05 GAB KIܬ5 rAB D6 AB D6 9GB ,6 AB AGLp8 6AB Dh8 GAB 9 lAB E p9 CAB MEEĭ9 )AB ܭ9 5AB 0: 5AB  p: AB FFF0; VAB EP`; JAB AGp; 3AB ; )AB  <  AB 0< AB Fخ< ZAB  = zAB D = fAB $> lAB <> iAB DX> }AB pp? LB ? +LB ? ?OB A@ BAB ԯP@ LB p@ AG @ bAB A A AB 8 A AN P@A AB E pA AB NIEB 4AB LB AB I԰E AB LT0F AB CF AB C4G AB LG 'AB dG BAB | H >AB `H AB D K /AB ḎPK !AB K fAB K ;AB 0L 3AB ,pL {AG DL AB \M xAB E|M AB M +AB M `AB F̲@N AB DO AB AGQ {AB F(U )AB @U uAB MF`@V  AB xPV FAB V %AB V \LB 0W AD سPW FB pW AD W AG  W GB 8W CAB PX kAB hX \AB X AB F Z AB FFEĴP[ KAB ܴ[ KAB [ (AB  \ AB FF,] AB FFL]  AB d]  AB |] xAB Dp_ ,AB E` AB CصPc AG pc AG c AG  c AB 8pd AB EXe GAB pe CAB  f jAB FIf AB Fȶg AB F`h 0AB E i AB FFF,j ,FB Dj ,FB \k /AB FI|@l AD F m ;AB KFFo AB Eo 'AB Fs AB F s WAB 8Pt AB P`t YAB Ipt LAB Du "AB @u AB Fĸ0v &HB ܸ`v AAB Dv AB Ew -AB 0w FB Hpx  AB `x 2AB xx hAB 0y ;AB py WAB DĹy }AB IPz cAB Ez >AB D { %AB 80{ YAB P{ AB Dl@| AB E| "AB D } AB @} (AB غp} AB } TAD } 7AB  0~ AB D< aAB DX@ MAB p !AB  &AB  eAB D` 7AB Ի AG   AG  ,AB   AG 4 #LB L0 "IB d` &OB | +AB  AB FI` wAB QԼ )FB   AG  NAB p [AB F<Є VAB E\0 IAB FF| \AB E AB F AB Eܽ` HAB  RAB E lAB FI 4 AB FFFX0 CAB FF x AB FEHP AB F AD  Ծ@ AB FHR AB F AB F8 FAB FX G AB BFx0  AB F0 AB HH RAB BFؿP AM p AD   AB R( 8AB FH #AB  ` AB HEI AG  AD @ _AB I VAB B AB VF AB F 4 AB IFFX AB Fx lAB E AB FO 0 AB HEE о AB FFE AB F AG 8 AB IX AB p RAD 0 AB E 'AB BF 7AB I@ ?AB  eAB I AB F@ AB X AB p0 AB BC }AB BC` 1AD  AB F  AB Fp AB C ( rAB FIFL KAB FFl` AB F` K AB F AB C jAB FIF 0 AB FFF  SAB FQF8` AB FzR| AB E< AB E\#AB E|AB Ej , X ohq^. yv P0@oooopoPooDPZ04ɲpگp׹ kg?ڹp<x `c0\PUP<`Ue P:Dy j0\nòSP0X@EPչoiPڹppֹ0kٳ˯Vpjoj0]eϯ`߹0+` 0 pspkЬ~PHϸ`_`h0r0ֹ XA6PW F g5U02 ۯ<`h@[P@ίD0t`\hV /p 0iв kKp]0`ѯIp4_ rPB0qWگ0_0WpSj 9`t+޲Z`UӹPo0IٹhNCКP=G@sǵ@@i]үp=`SPDk3Ep^@<0ʯ`6j@h h6H; D T a \&*U5 Xf p Pz L $   U r$< q(T'    2G L Q V + Y  ]  d  j  , p -sQ0 {S }Ku #T x { ~     ! # $ % " &=' (1 ) > <) -Q0 {S } ;> (7) )7 |7 &  ' a1 01 1 ;1 <1 01 <1 1 / `0 `1 :1 :1 :1 :1 :1 :1 :1 0 1 / :G0 G   B @=2 @=2 @=2 :#2 :12 42 @; 1 `2 abefhXikmnp,r$tuv xBXCE4HXI PT0+A A A A A A A A A A A A A B B B B (B 0B 8B @B HB PB XB _B gB oB yB B B B B B B B B B B B B B C  C C "C .C :C FC RC ^C jC vC C C C C C C C C C C C C  D D / D 1    J  J \J J ,1 ' N  P P 0  p     `    Ю а    @  B H ## cQ   T aQ   iQ `   U Q   Q Q P  Q P  U Q   Q Q `  Q Q   Q N    N Q   Q Q   Q  %( U Q  0 U Q  8 V Q 0 @ R S H R 1R  P @V  P  X 8R GR Т ` OR Y0 -h pV !  p lR r x r"  V , p-  uR , -  R p.  V a p2  R oN P8  W R @  `W R 0>  W $(D  W  @H  R R W  X Lh  R s  dX  Pk  R  ~  X R ~  X R   S S  - S T  - 2S ^@  IS VS @  [S > @ ( gS rS   0 rS O8 0  8 X 63  @ xS S  H Y S @ P S S  X S Y ` @Y ) h lY ] p Y sx S + Y 2 Z d  `Z j  Z  Z S  S S  S T   T T  &T ( Z 7T R  =T XT P  ]T K  qT T p  [ T p  D[ +  h[ T ` \ bH a B j i  eE ThHoN H\`j  1 i (X=kEmMCWn^fe|kbruztP8 $i p<vhL j i x?-& liW 0W ] i PW  \ ) s ` c 5 e c { @| t   @l `1 t 2 `|, @t[ p8 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v s 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v ) 4 Pt 0y 0y 8 p, ` P[ W o ' @  +           | P  } P pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW g + p_ Pc @4 ] pc  p p 8 m c , ' 4 ) P p8 W  = < pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW pW 0< 6 B x ) ] c 5 e c { @| t   @l `1 t 2 , `d  \ o PW pE a b { G @| PT b 0W _ _ _ _ _ _ _ _ _ G b b p\ R @Y p[ R G c I @c \ A 0[ G 8 S 0J X b I d @ pD R @Y p[ R G ] ? { @|  \ 0A @c \ L 0[ G `d S @K X 0\ @] 0v 0v 0v B 0v 0v 0v s ` c 0v 0v c 0v 0v 0v 0v   @l `1 t 2 0v , 0v pa 0v 0v 0v `d 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v s 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v 0v v v d2nL   B4K4N4T43Y4 @A !^<<@Ld>g>7 SL  @@@@@AA A8ADAlA A xA A A A A A B $B dBpB|BBBBBBBBB CC(C8CHCTCdCpCCCCTA C!C"(D#XD$D%D&D'E(TE)E*E+E,F-F-8F-PF-dF.F.I/TI/F0F1F2F3F4G5G6,G7DG8\G9G:pG;G<G=H>LH?H@H[ I\4I\tI]I^I^M? N@N[-N\7N\GN]\N^gN^yN_N`N{N{N|N}N}4~5 `e ddbash.debugi.ELF4 4 (444444  PPKؗ PPHHH Ptd\ \P\P\7\7Qtd 44HH !ohhx3+ 4y3p.pyv;o$2Ho4W 4@` 40 i,,;dDD;p oGAuX X{ F \P\ \7 P P P P P P $ T G  L   .shstrtab.interp.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink.dynbss.gnu.liblist.gnu.conflict.gnu.prelink_undo 4q4HqH !ohqhx3+ 4yoppPD 3^.^v;o42HoDW D@` D0 i,,KdDDKp oWAuX X{ F \P\ \7 P P P P P P $ T G +  ܛ+ K + + D01